WGRT-4T0 T1.0 -0100.00.00"3DUП'5<@DHLP`pPLPPO 08П 0 ('50J@-dQ P9@/ 0 0S/0@-P@Q Ё@0@/D-M@D0\`S^0 0S"H0'Sl1P`pӠP`pP`pP`p, 7 QA]40f 0S!0 P`pӠP`pP`P`   Q PAU 4 HHQA'ЍD/R4S S##RS0@-M@PEb0 F묄夔PꐄP匄@Ѝ0@/t/d/L-M@D0S8o` B$ 04< ("( R [ P  p0 APZP 0P @Tx=l ` 0嶐ᴓE #P^p4^p^p " ꬒ ^ "d^ 0S00<   \ L" 8 u06    RЀrb@p R- D @ R     R峀!X 0 J:8䐟|(/ D @ Ry  s   R兀 *h0  "8| ЍL/0J,04JDJSS Th S(S0T\S ЍD/@-P`>@T+0 p L  X0   rW@3;kP@/4pJ5lJ5Jh4JL$5L-YMPH\,@.@ 000u\ 000```ppp@@@ @p`T^uT/}p>]0 xO@ Ġ Ƞ,Ƞ` Ƞ,ȠLĠ`  Ġ Ƞ,Ƞp Ƞ,Ƞ Ġ ` V */  D>/ Ġ Ƞ,Ƞ` Ƞ,ȠLĠ`  Ġ Ƞ,Ƞp Ƞ,Ƞ Ġ ,,X0p.pU}\.  >, B"R .  > $("( 0 ("(` "$  00 ! R  ! \-  ~= ! ! !A !0!!-RQ ,44JPU@6!l0!`)`" ̠ \0 Qk+,,v=/a\* `0 h+((]= H p $,`\4 \FLĠ `dl 5\= :@` 0` 0<@ ((0`P  а` VP .`` 00\P00C 00P0 [QS,<<0[G 0.00, <.ԙ ,` 0! !A !0!A !0!A0!!!! B 0K: "$  ! X008#8 0#4 00010LĠ @DL LĠ @DD@`dl@@DL Ƞ,Ƞ0ǟLĠ @DL LĠ @DD@`dl@@DL Ƞ,Ƞ 8p$`@$(00S (0@@0 $(080.$$p`0C40 Ġ 0V`@$(00S (v0@@0 $(080$$p`0C40 Ġ 0V80@ ԕ@@@ p``A $,V``A $,Vx; 0,0$  0,0 0R   0   $z:` A< 0 EZ A  $,h&h"!!   !!`FV`Fh&h!!   , "(("(`FV`Fh&h$ ",8 #4 < 4 0 < ("(("(`@+R `h&h$ ",8 #4 < 4 0 < "(("(`@+R `h&h 0\ LĠ `dl Ƞ,Ƞ;U `\\* 䑟$ \! \ \P \᣿\ ~:\t:4 \ \  !`0  B 0   L L0 4,0   R>:SR  $("(0 (! 8! 1 * !!`FV`Fh&h ! !    , "(("(`FV`Fh&h$ ",8 #4 < 4 0 < ("(("(`@+R `h&h$ ",8 #4 < 4 0 < "(("(`@+R `h&h 0 R  B$ 04< ("(   B "$    ("( "$   $ Q  Q  4 Q  8 Q  < Q $ , Q Q &((~8 &Q* ^`0 '((a8v H `V |',,H8] /$ Q (4 Q p  40Rw `8   0SY! !A !0!@Q `0  (DDW8 BA0A0 `! !A !0!p 0   B "$    ("( "$  YߍL/p@-@P   Q Q Q$ Q Q 'H*  $$h*  *  =*  j *  *  Q :V Q( `N4 Q `F8 Q `>< Q  < $"Q 0`0  E+37Hp@/p@-M@lIm\TP8P0 @;mT\ Pd``0 /m넜匜 P0 &m먜$尜(P帜,``0 m؜LP0 m48P0 m @(HP0D``0 \lP0X  Te            0 eQ pp 1     ", "(  "$   " 0 xePU`eЍ@/h[J0rJJJPsJ[ \x\[\[[L\,\L-M@pPA $,`V*궠 Q0 Q  7   W  P! R嶠 Q )J` A 儙`f R 0R] R 0RV R 0RO R  0$ SG 9R$t R! t   Q   X  *  Q:T(Q  0` `V 'n`V5Q 6A`'V TQHh Q  E`z'V 6_ Q `W4 Q `O8 Q `G< Q|&t P0  N8&cЍL/D-Mp@1  B P`Q  !ᰠp 0R  R1.8(! $l $       ("( R$  pB 0 0ğ 00 000 04#̠ 08#4 0<4 00< 04SO00`E 01[\`P0 5[0@/0@-@d$hP0 '[@lHpP0 [dtlxP0 `[눒|吒P0 @ [묒崒P0 [ВؒP0 ZP0 Z P0 Z<DP0 Z`hP0 Z넓0 lZ뜓夓P0 LZ0@/D- M@P`p  p`0 Z,4P<`DpL p`0 Zx倔P0 Z댔唔P0 lZ바帔P0 LZԔܔP``0 vZ ЍD/@-MPlZ8@  `pp` 0_Z@TЍ@/L-PM`᜖ RNZeIZl@[ pP * + .ḑI 帑$$ (( ,, 少44I88 <少@@ DD HH<00  0 xZUhZ궠4TP8S 0SS XA")0(0Q  5   XPU(7`vGV (`Ѝp@/0@- P@-R RR ` "(P"U (P0@/D- `@,R RR !d(P (Z@P P(O  Q (B$ Q (Q (P 2 PU(%@ R WV  0`p`pᶠ`p`pᾠD/0@- @+R RR h!U @/R  R (I  R (A( R < (  qPU(.P((Q@Q Q ($' Q (Q (Q   qB(P 0@/L- p@p)R RR P B(P (8 0PU()0000 0 *`V  0ppᴠᶰppἠᾰV (`L/L- p@(R RR  :( 0PU()0000 0 `V  0ppᴠᶰppἠᾰV (`L/@-0@6S 0SS [ 0(0 0S (0@/@-0@d6S 0SS D< 0S (0(@/@-MP p` @P ((+p0 P:U (PFЍ@/D- MP p$` @,ş\ \\ (p0 P 0S 0   D-U (PF ЍD/L-MPp`$@Pğ\ \\ 0;(P 0 40V (&[ PU(P`0 ZpU W (pFЍL/L-MP 0 @P (H(P 0  ;[ P3 P + UP`U 0  pcW W WZ ( (p Q`FPEU ЍL/0@- P@!R RR  (0P*U (P0@/@-@Q QQ (@T @/p@-`P0@T000  0p@/@- 8Q QQ (@/4g@-0`pW  pPWPU1Q ,xӥ @T# 8r40000P 508#VT 4 0P$P"@@T PP @ @ PPp@/p@-@P`\ 0 0S*0E 00vA 0? x0S *0S8 @?6 0- `02 kSi1|dp<<<<<<<<P ,$GT$B ;7d4D1X.8+4(T%"(([@P   ᖒ`p@/@- ( 4 @/5@- 0   $@/0@-@PU  R \O 4$ ($4T0@/@-@ 8$rT4@/@-@ 0$aT4@/0@-P!B"2 ??RHxd @TA 4 00008#8000008C800022X X %0000t00 0 =0S 0 0 3Q T០0@/R20 0  20!0  /0Q   R RQL L!/@-  T@/@- 4@//@-@@/@-@Q 㴆 Q @/0@-@0PT R 4 Q T 0@/ @ R@ /@-@ @/0@-@T 0S 0PU0PU  s0@/p@-@\ 0S 0PUP`PPS 0PP Tp@/L-@P`00S AQ  A P6 0S. pPppᲠᴰppẠἰP\ PU00\ 0V  L/@-`@PG0S0@? 0S 0S 0 S LNHMU! 10S 0 0 pLp G S* 0 0  0@ 0 00U @@P0@00T@/@-@Q TKMQQ@/p@-@P R `%`#RV/M `0S 0A0  0APE0AW U0AL R Q R  ``p@/0@-@)PUe 0Q0 R QR QS 8@0@/@-@Q   0 B Q@/lg4$"|ggggL-NMP`p@  U  4 V  0404 W  0h04  08 0S 0400S 0h00SZ 0Z Ԕ0[Ą㋾u㠾 0@T TU 4 V 0404 W 0h04 NߍL/L-M`@  R:  R ```4 p4 P !0  R  !0 P U@T ЍL/p@- `P@#  R5:  R G4P PB P P<P P7% %3XT AQXT  A RQQ Q PTK,Q@Q P (Q (Q (Q P44p@/D-P`p@  QQ@ V (` @W TD/@-@$4T@/@- 01 P 01001 000 0P:  B  R:j@/ R* 0  !/ 01 00S 0R/h$"D-`@40Te P0 0CSPU0S! P0 0 pCWڸW ?||? (B(00C0 000Ph/000T/0 00& 0 0pBW!ڸW ! A#  Pp,:U 2QQ7@T T Q .QQ & TT!P p @ R 4 nT T Q 4$D/L-8Mp4@$`L]dd@]$$ PEU  P(U*: 0S.:8 0 BR d0 BR$3   B<3     븲@8#8[:8#828#82 00CD008 0CSHʸ0SB1 S>000 0S 08 S 0$0$00$0p S( 8#85 0C57 0S T 080<08 0CS80<000S1: 0S:! 0S$ *[( 0 0S ! 0 08 00[   0  [ U 0̘ 0S2 D0 0CSD0 S)H0 0CSH0 S 1 S0S H0 S1 S|000嶑ᰕ0D00H05 S58$ 0S< 2S9 0 S00S3240@ S02 0p02 0X 0CSڶ"0 X X T0 B40  B, , R @ G8002 S0@?S  4T0X 0CST0X00S0SF 0 S00S@0T S'0S$0S!p R " "" "0T  T ! p|:h  h :l l 4 Q4   ; p" "` T0 B80 C8R("(( p R1  R R" "T  T   R R R  R  R        0䔟  0 $X" RQ 'N R? " "CD<4  4 X U R) \#\ pp 0 \ ppp 0X ` X ! @X S8ЍL/L-M@ Pp<0S; S``V3Q+V)!Q% 048#8!A"$,!Ḓ!X!!pGPW ЍL/p@-P0@20C` V P P``h``P0E0C 0   B  0C @T Sx]Cp@/D/xQ$ pAx !AA0x  x R x  RaA| B!(B(AA ||Q|pxp|pxA| A  Q  Qڀ /4,Q (@[Q[[/%KtJ&KgL-M@4 d 8 R< 8 B u&Wڸ& R* D&p"R Wp    T\ PB ̟  R 0 h̟ UPW 8<UڸR< T 80 AQ84 AQ84 Ap` W`| Q TQQT <8 QP QL QH@8 AQCU U> XQ T Q2Q/U+<d AQ&W`T A G4QRd 8 #Q*TQ Q Q2- `lU? `FVZZ+ `Q U Q T RQPV  AQ  BQPHpAU8Q$pPAU# V!  AQX0`V00(00(00000(00 0(0C 0d0`V(00 0<0 0U l0 000SU" 2S UǟT00T08<0d 0CS ǟH00H0ǟL0 0L0)ǟ@00@0ǟD0 0D020S lǟP00P00 S Hǟ`00`0 @08 0CS ǟX00X0 ǟ\00\0 00C00Z*YA 00SRA00 (  Q Q <d Q<A<<!,<! < <T!,T! T TX0 @000SSr 00lş 00 S 0 @m! !8!WWp`T AW`T pA` W`|Qp ꨔA⬔ WڈA⌔ !A("($,!@< AQ@< A!A@ <0 B("($,!! !8@U T Q!!Q Q;<  Q << Q <<0<<<d0AQ <dpQpt " Q<8 Q   Q   < d AQ< d( !!< PU U  Q`4(  ( <  < W  T ` BR T ` " "XЍL/0@-@xA| P Q \? L!A  P   xP x P0@/@-@Q Q    ,B$  @@/g(K"L(osghLtth@KD@<4,/@-4@0Q(ِQP  P !@/L-M@(P\ 484  4 AQ44  84 A`A$X!@7PU p( AX*)? (0 S@$,~0000<0V: ` 00<000 0 0(  `@p(  !!$ Q #88!A  ("($,! !( "$, $ , !( "$, $ ,P $!!A("($,!(!!唒ЍL/@-@Q-[4@x| P  Pڀ X T @P XT @  @/p@-@`4PQ[d1  P1   (`p@/D-@4`pP P U0Q 0 D/ Q / 0@ ! R/ 00 R/tt0htt4KsL-ДȄĔ@N0S- pWF 0 PUA `01 00S 01 00C0S0000 0S`Vl00l0p0S p00p04P10S ܃1 01TP10S 㤃1 01 @T|x#hP PL/ ! 0 00Q/0@-M@\:v \: 28  8 @ Q l娒 Q ⌒@2,  ,    R X2$  $ @4"((x@|"@ P  Pڀ Px@||x8<p&5S Ѣ" R* !"!@$1,  , **3P00\x4 \! \ʜ崐PlP UgP448L 0TL 0t , 8Ѝ0@/\9\,$`\,4\ \ $``0 Y R  R!RG`  Ѝp@/@- !  R @/@-@ (Q (HWҋ@/0@-P00 @ 0@/0@-P00 @  0@/L- `pἡP0! @R+@ R S@ R S @ R Q@ R!R Q @T  R T`V PU\  Q\L0    L/XK\KL-`p㗫Ph@ Q  Q Q Q㜫!P@T㯊@T㍫U @Ȁ@崠p `yL/@-@Y pQ  QQ8b R U@/`KQ R    B  0R  / R  Q / 0RS   R0  B  0R  0 R/@-ph'@!BH+ᒅQ 0 9, 8@T@/0@-陪 R 8k@M*Q)* 1:$* 1x:,\* 1H: 0,*,*  * 00L01ɟ 01Y000 QR@T9 R  9x㐉_ R <8 \@=`Qq븪- *a=@QQ Q Q옟Q';lL9И@Ĉ弘&ଈ되l0圈0@, 1 !8  1 !h8  1 !D8  1 !,8 0 01 ȟ 0Q01W0 0 0@ؗ0T@01ǟ 01W000@T080 NA}@T!S0@X'X>AY8',Q _0@/@-㘳넖Q 㒳&8@-㈳sK&尖Q z@/@-wQ 멳˰`&LQ a@/@-䕟QXY눕Q R%ܕQ E@/p@-P`@6V5%dr7 n7D-27 000d7$60 00Z7,60 0 0P7060 Ḕ00F7@`Tp@/@-Д d@/0@- @P4 p$P =4@ T$共0@/0@-P@#Q#D@ T0@//-#  01,ß 00S 00L01Ÿ 01B000 R Q 1 C !|2 00Q/Q$ 00L010Ÿ 00S00L01Ÿ 00S 00@! R/PPU!Q!B !d1  P!Q;!B !1  !0   Q!B !  | Q X  /@-,7@/K|KhhKHgQ, X@-M  xЍ@/ptmxjjm8{P9P<59"@5{`5z5{m PWL-`00L1 @00Sv 0Ss 0S 00S P 㮴P嚫000SZ P00S*0 SRpq侟pZZ@ZPZdZxZZZZZZ0S ?0 ̠L̠:06 |嬳0S/ 嘳+0 ȠLȠ&0 Ƞ,Ƞ!00P00S P/000 ̠L̠ 0S P J00` 0VzL/p@- M`P{00L1 @00Sp 0S 00S00Seh0 S`1͟0][\][\[\\\]\ 㥳0\\ \AD  /0S ;04#̠08#4 0<4 00< 000 S 0 S*! ۳000 S  ҳ0000S0 S 0 S*P 0U Ѝp@/@-`Pp@+0 0S 0S 0S 0S 0S ,Ȳ@ò@ ᾲ@Ṳ@ W Ჲ@ @00P R@/p@-@MP0"\0@ ```@?T  \>\"\ 00@ 00L1 0 ? 〲0S @ 0T@@Ѝp@/p@-M@P000〉00 0S0S 00S*0 S @i __ `X`p`````aPa0Sh 0S y *s *m(e  R ] @ 8W h*Q T*K 8*E0 $*? *9       0 w*' R    ر |c*  R  O  ,I @ Ѝp@/@-P`pự0@600F얟0L 0j0 G봖आ@/@- @ R  "P 000dP >Q Q"Q@/L-MPpP>K @ `  X !5  0 ᥱ Rl H !T5   ᕱ R` !5 R !5 R ေ R`>\t 0 ᰔ q 00S0S 9|$|4 "00hd$h4 \L$L4 ٰHN0(ğ(T 0 30#3 M R #3 а0Sp嚨0S p 0@W # @@>ЍL/0@-P@@X @   ,J>㔰0@/p@-`@@P>㉰ @ R 到0S"@@p@/p@-`@ ذ P @ 0 >[0P100E0L (E༑0 0Cଁ0!@p@/@-P@ ᤰ ` pp >)0` 100F0L 0F  B䀟 RS RP ` Ԁ B00S @ 0 040 0 P @(p I @!Yo[dnln\ntn|n"_nnnnnn(Pnnn"nnnn"nnn 8 `0 L\0S@/L-@တ00 ᔐ0g밐  ܀ ``PP R >Rа p !1  R pWZ R) ` 00S: 0S: 0S ` ` ` ` `,@<L/DP@- X Z@/@- D0 S 0 ,=(= I-@/@-@ R  ; 7@/@-@ R  * &@/@-P ӗ@/0@- M@P` L\ _$,$$ 0o Ѝ0@/0@- M@P ؛\ _+ 0R Ѝ0@/@- M 0Qp\ _H+\H 08 Ѝ@/0@-@P8 gy0@/@-  G' @/@-  ?' @/@-  7' @/@-  /' @/@- 0ᴊ0 @/@-@ᘚQ  /넚 >@/0@-P@  !D: / R@ !: R0@/@-  ^@/@-  V@/@-0 0SKG@/@-  ?@/@-  d7@/@-  H/@ ޷0@/@-   @/0@-M@\ ,\P,XPP,TP0 &Ѝ0@/@-  @/@-0x;Sl8h8 d ~&@/@-  H@/@- @  R:  R:" &ʛ 0ǟ 0ǟ t p0 꼛 0ǟ 0ǟ 0 ꜗt 唗p0 ꄗ |0 t?&@/@-``娭\\奭X;D00L0440<0$809<0얟0@0ܖ04#̠̖08#4 Ḗ0<4 ᤖ00< 0ᐖ00C4#̠x04#Lh08#4@T0<4@@00<0,@00C8#4 04#L08#4@앟0<4@ؕ00<0ĕ@00C<4 ᨕ04#Lᘕ08#4@ᄕ0<4@p00<0\@00C0< 0`D0l5M?0LH0X5M?08I0H500$L04500P0 50 0T05M? 㯵 01ğ 01D000 R$(  t !嬔 d!됔 H2!h$ 44!T$ lج@$ @\Ӭ@/@-ͬʬ00䃟;Г40؃080ȃ0尓3ሃ0堓@0x0吓D04#̠ဓD08#4 lD0<4 XD00< D@04#L4@08#4@ @0<4@ @00<00L0Ђ02M?2M?̒20⸒L20⤒P20␒T 2M?  01Ÿ 01pB000 R`X\\TYXPV("(  10P! !4,J4#聟 !! ȑ410! <! @7@/0@- M@, RRRRPh 븐  ` D 또  x $KR" 5""4@d|2S ddT ,( @! 0H 22>00 00303  @_b   @0 D tЍL/p@-@ 2 C!2 Pp(R  ` ()`!*K8+A,-ՂA.0<(@,DHLPQR { p@/@-MP}@A"Q=T``0m\?`Tp8S 0 0L1X 02S "B4!0 "B!0V 70C0C 0L1 0<0b0F1 00 0L1 01먐A✀ 0 x\0 p!VXT`xdP4=<=X\LPṯ<5RԲ<(Qܞ/ОLĠ rt| Ƞ,ȠᤞLĠ ┞rt| Ƞ,Ƞ|Ο xΟ`όZόTό0Nό Hό BόQt#Q k/ 0Ѝ00V7 S }^弑7 0L1 0< pG(T:p8S 0 0L10 02S "BT"0 "Bt"0t 0 0L1 0< ?뀒pQ Q  R 1`  q@ /Ѝ@/@-00 Rd@/@-$M0@                0 x $Ѝ@/p@-M0`@02DP<T  - 0  Ѝp@/0@-M0P@TԚЊĚ帊尚Q ┚4- x 0 l Ѝ0@/@-M0@0S,0$Q 4-s 0ؙ ^ Ѝ@/D-M0`@02|Pt\dT -Op0 0 ЍD/D-PM`0YPAQ,HLpxF0@W(pU`20C0C2 D8 02 002$ȟ 0,A QT|,Upp㈗Z7000S: Q3pQT, ,"Q @4,Q '  `,Q&  &  @ⴖTt0S6000Sz@TW l02,Ɵ 0 㞑0S 02Ɵ 0 < o ^@2TWȕ22SuP娕22ş 0 j눕| U+02Xş 0 Z@,Q$%  H,Q$  $  @̔Tꌔ ,7 o5{X 5PЍD/@- @0 SlRlf`b@/L-M\0,$\P@p\ ܓ<&@ Tp @Dⴓ<P U PE⌓,\x, \ \ : \: \r`p`v`i`$@\ D\|P蒟@D\Ȓ@,̠崒@,Ƞ 園@,Ġ 0ᄒ@ ||u .`D,̠LD,Ƞ 4D,Ġ D @,̠@,Ƞ ܑ@,Ġ 0đ@ |E 뤑H\ L\\⦐yh`HL\HH,̠4H,Ƞ H,Ġ 0H \ WL,̠̐L,Ƞ 崐L,Ġ 圐L 'P  pxl7<7̳X`8z,дlxpt H,̠0H,Ƞ HH,Ġ 0`H d\뀐 #R  #>RP0꼐 #Ȑ03Rܐ #B$ 034< P #B$ ,034< 0H #B$ \ Ġ  0P|뀑<̙L夑<Ù ȑHؑD@< 8P4pL0,@ %( P $  * \  4 " |  L " \ ) l   | (   唒 <0園  /000ĒЂЍL/L-MDR 娌 㠌 唜 R| , Rh ( R \LXLH ) RD\@\( , CR  , DR l00 `ܛ , @R:{ě00 pᤛ , R ꌛ00 l , R dT00 d0 "000 0D0@ 4 \蚟 "080l Ț0L弚0H < H⠚ * 0@0P ‚03p03 ,($p ` @<84 0   P0 Dmɟ000 ԉ Й00X0ЍL/X 9 , R☙ P/D-M`5 Ph)H  ㈏pQr0@TX0 ɟ 0 X <pTPPO\PT@X(,@Q:"EX|(<zXd(<?h.Pȟ`\H <ȟ`\B P (  R!'` PG *p9@X'(B(#BPEUPXp', Q 0@X0Hǟ 0X ˖JP(Uǟ\ ǟBό\ 7'ƟBόƟk\ƟNό\ ƟTό\ 6&ƟTόxƟNόR\PƟ`ό\ <Ɵfό\ T6T& ƟfόƟ`ό1Q,z셟+xƟ Ɵşόşόşό0ş~ό şxό|şrόo0STwX5P SڀKn42 S 2S {Q8뤑X` Q Q' Q \밑\X㠁\唑Q `V  `\/h:wh萟 (P_ X, D/@-M@ᬐ$,̠嘐$,Ƞ 倐$,Ġ 0h$ Ѝ@/@-  0 @/.Q0@QSDQ/@P.Q({Q!  @Q.Q@PUP*P*ЍD/@-M @岃8  PЍ@/ᬻл0@-P,,圃g R 㞐 @M/0 R M/0 Ry M/0   R tP@TU0@/@- Q !H$2 0@/@5A#\hHg  45p@- P6 @T @`@P@p@/@-MP?D C@8P"!/ "!.  QЍ@/ 2 1 !@/D-`p Q + 0@0  0 018Ο 00SP 0S:0S0Ο S -0@ 0D| R   5" R 05S p   RP   R  R R R<-g 2 1 !=  R R:u  R :\  R  RX",LWC<   2 1 !p*0000  0 01H̟ 000S4̟0000  0 01̟ 0 0  R ;  7 } 0 +W+ 2 1 !P 00S 0+W;     2 1 ! Q 2 1 !   2 1 !t  ' 2 1 !H 2 1 !(:    2 1 ! 2 1 !9  !1 C  2 1 !น  2 1 !|pi0 2 1 !D0Q09   2 1 ! 0 }  2 1 !$20 AAWh 8  7p8  \ /S 0($48   O 2 1 ! $ 5  2 1 !  ᫕D/p@-P@K/e0001pǟ 00000S 0S 0S 0000O 501ǟ 00@0S001Ɵ 00@0`0000000  0 01|Ɵ 0000  0 01TƟ 0000 01\Ɵ 00D↉p@/L-MPK"`V+K"!%0%"!%@dh ("( pv0S @5000@0@50@0@01 ş 00S9 01ş 004#̠01褟 008#4 01Ȥ 00<4 01ᨤ 000< 000@20@00 0  0000@0@<0@ @0S @ @D@#  60[:0@=0@0@01<ß 00\ 㽈@00S0@70@0@ 0ؒ S0@D2Z A $2 0C@0  0 010Ÿ 0@0 0014Ÿ 0000D00  0 01 00S   DC֒000 tHЍL/@-@Pp0001 P #  00`V 0S  0001h $ @/L-MP@㮓 pWz!cSczzzzh$+ z5z $A#zzz,T"!x 0T "!   0S 0000@0@50@0@0@=0@0@018 00\ 㠇@0  0 01Q 0  0 01Q 0  0 01QI0  0 01$04#0  0 01H 0$08#40  0 01x 0$0<40  0 01 0$00<@200@0000 0000 0000 @Q9 @ `@~`@<# `T{~[:@Q `@p~ 㗇@`@# `[~0[:@Q00@ 00 z@@~@0@<0@T ن@`0S0@70@∔0@d```0⸔ S0  0 01 00S 0  0 01H 00S01< 00$0 00  0 01 00SI0  0 01 0004#l0  0 01 0008#4`0  0 01 000<4`0  0 01H 0000<000@60@00 0  0000@0@ `D6VA Ά60C@0  0 01( 00S 0  0 01T 000 00 001P 000 0D0 DCバ@<   2 1 !$0 !"!"!0 ЍL/D-MP@㈑ `VT"!(0("!( p0S 01 00$0 089000@0@50@0@0  0 01 0004#0  0 01 0008#4 0  0 01 000<4 0  0 01$ 0000< 000@60@00 0  0000@0@Dx:Z A ׅ: 0C@0  0 01 000 001 0000D0 DC㚏 G"!l\ЍD/0@-@x+0"!+$ $R +E|+0"! ,$$,0"!\,(,L,0"!,,0,,Qᾇ"!, <,(, =0 ,$04<- P=0d ,$08- =0 ,$0<2"!. =$ R .0"!h.$Ml% `>Y+P 2 1 !>0 !40 OPU0@/@-@.y{$ ,<0X4t8<@/D-p@㦏0PU1@`   50@@00pD3WA op30C@0 0 01Xß 0000D0 DC:43  D/M  000 000 000 Ѝ/L-`@N2120(021X20,02102002124  0@00S: 0S 0SN 0Sy $0S' 0S@"!!P0(0@0@P0S :"!8!p0,00@@"! Pr!|mApgpa00<00@`0@Pp"!\  4 G00PEP@p0 D<zL\Hg5z!S*W0@30@P0S000p0 0  0 01| 0@݂"! @ "! @E0@00@ TCOL/p@-(MP | w r m눑 h䞟 c؞ ^묑 Y뼞 T밞 O뤞 J똞 E@   !( !`Ο 0 T3   !l RA    !    ! 0   !    ba c ba Q/p@/@- $P /21>0 $$21?0, ,(21P?0h 0,@/@- Q`\@/"! P "! P Q/"!!lzzzȽzzz(z@zXzpdzܾ4$+hhP! Q "!@P/@-0   !    !     !@P  B A !A @!i@/@-@Q-"!HP "!t P$"!Po"!P[ @/N/0 S0S 0S000Q:/D-@`p0S~u R eu R Ax p ` t 3`0?Si,(01ş 0PP0Z 0Z`P0SV  Q D/@- p@/@-TMP@@N -J~`N`pp`V \0 l`` 0 d@`V \TЍ@/@-0 !xß @/@-lP|SQ tS@ T T640#Q(Q쒟t@t=7kԒ ?S"*堂"A吒Qxxt TTL@ RB*0"0AQ*S3 S0T!Q) ̑ !AR RRT !AR RR\X!QH@T@/ 00 S   0S0 SP / R R/@- !P0 R8 QME@/(uu\zza#z dK@-@  䝟 h ^@//@- R s @/@- |t gl @/@-M,L@,H@@,D@0 0$ S Ѝ@/@- -M/ R  \: PUxb hv,(,̠$,Ƞ ,Ġ  (,̠(,Ƞ (,Ġ ( ,̠,Ƞ ,Ġ 0 -P@⠕ q  |p T:Ut0Ѝ@/p@-(M`D P@ !0 PT<   q0PU 0PP0 S Ĕ ?01 0 01 0c0S 00@ X$@T !0 Q#0   R(Ѝp@///p@-M@0\ , 6$P 00` V`` 0S  $000n 080e$,̠$,Ƞ $,Ġ 0$ lT`Ѝp@/0@-M@t0\T , : 00P UPP  0S  000!吁Ѝ0@/@-@@ 0SL   0 S00Sh R R  @ @/0@-3ul#|4 4 4 (+#,(ohz$5 $((,5hpJJP5(((M@0\ ,  00P UPP  0S  l000ĀЍ0@/@-@ 0Slr  0 S00g RR]t @//0@-M@w0\ , = 00P UPP  0S  000$$ Ѝ0@/0@-M@A0\x ,  00P UPP  |0S  ܓ000P Ѝ0@/0@-M@ 0\P ,  00P UPP  F0S  ᴔ000|  Ѝ0@/0@-M@0\( ,  00P UPP  0S  ጕ000Ѝ0@/0@-M@0\ , f 00P UPP  0S  `000M Ѝ0@/0@-M@j0\Ԗ , 0 00P UPP  0S  8000 Ѝ0@/0@-@5 P R @ n0?SS D  TZ? w<(Z/pn0@/0@-@ P Rt @ ]n0SSʰ D  Z@ yw|'Z/@>n0@/0@-@ P R< @ +n0?SSx D  Z? Gw&Z/ n0@/0@-@ P R @ dm0SS@ D U Z@ w%Z/@m0@/0@-M@l0\̚ , 2 00P UPP  0S  0000,(Ѝ0@/@-@9 0SH  0 S00Le RRڔ3P/: P : P (\MPM8M,MMM MM@/@-@ 0S  0 S00d RR H @ 0 @///0@-MP R 0Sr? @Tg4b0S 02 |X pT dP\M RHG 00000000 8    RЍ0@/0@-@Y 0 R %PK0\ ld0SSl 000 \S  (0@/p@-`Pl0SJ00S09S00S? 000C0Cⴐ S/*l'""""""""4 4 4 4 4 4 4 4 (\x4<LLJ0@T ܓ@#l0S @TT p@//0@-@ P R@ @ t l \\ D e0"ܒH[ uk0@/0@-@y 0Sl L ?c PUU, P / T ' @ 0@/0@-@HPQ㴁4k RRt \  T T T tDk0@/@-M,!,!t$$,̠$,Ƞ $,Ġ 0$ АЍ@/@-0တ ` UI T@/@-@h Xds8 d vIS@/4du$f((\\9<55dK$",8#4 <4  B$ !  /@-,,/Et". 0  `P`崎㬎@/ጞP |t`h`d.@X./d Q ``.-A؍/D- MP0010 @C1S\0018#8p048#808#8C4048#8`08#84< 0 0C8#8` /s벡 tt     B$ 04< ("(   R   00`h&h G008#8PᲡ  r  ЍD/,@ + +P* ԋԛ 0R `P /@-Q Q Qp /Q` 2PT {DH @/@-@p R  0 "0}0,8#8 "p R 0 "}0 p R 0 " 0 "10,8#8 01dʟ 00X0!P: @( ` @p R  0 "0}0,8#8 %p R  0 "}0| p R 0 "p  0 "00,8#8b P\8@0}P P P P P  |㚪@/L-`pP$PP<@ "QA"$,0`@TRPI @T藟 R  R !7R  7R 꼑ᴐQᰒἐp}`倗 x d R"!`7 $   p l &ؒ|,倐p R  0 "0}0,8#8 %p R  0 "}0 p R 0 "  0 "10,8#8  !6 X !6 @ܕ ` Ѕ@p R  0 "0}0,8#8v%p R  0 "}0ip R 0 "]  0 "00,8#8O !\ !@   }\ \ \ \ \       |   }㇩L/0@-@P$ R\ `0`0`00` RR~jp R  0 "0}0,8#8 0%p R  0 "}0 0p R 0 " 0 0 "10,8#8 0 !ß R \ X0X0 1Ÿ 0XX RRp R  0 "0}0,8#80%p R  0 "}00p R 0 "0  0 "00,8#8{0! R \ \\ |1\00\ RR¨jH!  lQ Ua}  R,  R R  RR  R) M AdQH UFd B A Q: Q6dQ3 U1dd+\ A&d,+ ܀ 6("6:> Ѐ؀5Q UddZUL0@/lQ l & B&/0@-@PlQ lP0@/L-鼰p @Q}Q Q Qt Q} Q QX: Q : QX QQNVꈙA!Sp x0 BRLPdJP,PU00.00(000 0Б000( [o 0p 0p.`04 !pf P!8㼧 0R* ' Q!Q: Q xx Q: ㌧x  Q*`@T$`@TGW$d ,$ pQ0@x A<Q`@T`@TL/0@-P@㔔'0R Q̔`@`Q0@/ !4 $ R @ Q/0@-PP@ Q`@T`@T0@/%p5$Q 50 Q% 0 ş S!$!P(@ ̄/0-0$!(\ BDD@RT\@\CDD@ST\@\)\ )@\0D 0 S0/0@-P$Q @$t@T$0@/@-Pp ȓ0QL$Q $吓020 0`00,Q4 @0 Ae())*K8+,.#SA-00,008$<LpLH@D;`V@/L-lMp᜘ dd\ eP`@|}  * + .ᴐI 崐$$ (( ,,   0  _|d P * + .ᴑ44I88 <崑@@ DD HH<0弐PPITT X弐\\ `` ddXLxhhL 0 0 |p `dP`@`T@PlЍL/ԀրeDX0S+02 } Q-X)!Q%X! QdQ d Q  QQ QܚxX0SЍL/L-,M@  Q p`PA04<}QA04<}Q n MmHm00048#808#8C4048#808#84< 0 0C0CS*F0$$ppp 000  @ @@@@@@@0@  h@T YQ $$00000000d`t(t l,ЍL/L-M@ pQ ;P`A $,}QA $,}Q  ll  $("(0 ("(B$0 $("( ("($, 001 B BR* 0 0 0000000 R  R 0 #("( + 0 !xƟ @2 } R- Z* R& [# Rd R d \ \\   \x\@T !5 @ }0R Z 0R [} 0Ryd Rv d 0 Sq 000 Sj0Sg000Sb00  0000 0 "10,8#80ሄ0〄X$P>}Q6 Q2!Q. Q* Q&xK Q dQ d 0Q 00Q 0Q   Q XPXPt#U\@TpЍL/p@-@P` %2# }2PP PdP dP X\p@/L-pRB gk`bk p 0 #("( '(}PV P W Px P:x\Q L/@-P`p &2 x }2PP PdP d@P \\ !}2PP PdP d@P \\@/@-P j@j Pxpt` 0 #("( %p(}PT H>F6؀pX:pHtH !P U PTxXQ@/@-pdPh@ j`j p 0 #("( '/}PV  P W P,x\Q@/D-xMp@oj`V# hjPP bj!` \j!p Vj,̠p0    DjP?j` 0 PU d $Q<9 %jP jp ppppppp 0 2t0PU ~Q `dz% X%R `UJ  0i "$  !?? =! ! %! !A !0!!4   $$儔xixЍD/D-xM@ipW# iPP i!` i!p ~i,̠p0    liPgip 0, PUD d 0S=p 0 "2  &`(}2Q  Q QxKP QdQ d  QQ Q X`X`&V;PUz`  iW PPPPPPP 0 2_0PU i R pd d! pQx!xjKp) 0h "$  ! ;! !  ! !A !0!!d0   ȘxhxЍD/|>@hP(t@- P 12؂!"市㰂㨂㠂 9F@/@-QQ][@@"Q $"Q;[@/@-@`MQ<MQ ![ PQlqPPU# PQPqPPU P@qPZU\0 0 P$@/@- A딐$l倐,\@/T $Q P/<5 e85xHԀր Hg5i@-O Q f@2P@//L-,Mp(048#8  ("(B$ 048#808#84< ("([*(P( B"!P E Kd`V `d`(! B$ (104< H$H0 S:i B$  Ġ  R $"̠ ("$  ,$  , ͟ R L0  B$ 04< ("(00S 0S 0S 0So 0Აᶑ  "/0#8#8 0 != P!1R} /R f X  0R f X XPUU x $l R @ $, @DT@DH$H@ $, @@ P @H$H@ $, (0Აᶑ  "/0#8#8< 0 !d; P!1R} /R f X  0R$ f $X XPUU К x $l R @ $, @DT@DH$H@ $, @@ P @H$H@ $, (YW >f P 9fw ppppppp 0 / PU9 / } B$ 04< ("(@DT@DH$H B$ 04< ("(@@+R @H$H  B$ 04< ("((! 렘x,ЍL/L-M pdPU` $0 L  0 C B10C40A@DL0H$H  \:  B$ 04< R04#,08#4 0<4 00< |7R 0  B$ 04< ("(``V `V `V `V3 _^[A $,!@DT@DH$HA $,!@@Q @H$HA $,!A $,!@DT@DH$HA $,!@@Q @H$HA $,!wu 0RD Აᶐ 0 0#/ "("(H%` Q}/Q Q  Q  dX \`VV gᐔx|%A $,!@DT@DH$HA $,!@@Q @H$HA $,!ЍL/@-@  !("(0AAQ*`Q A $,T#Q dP d  %0/0#8#8 !2 P} /R 0R p qd Wpjd W XPUUK 0gd "$  !?? v7! "$ 2   $("(!A $("(0 ("($,! 000$$  $    Lxd@/@-@  !("(0AAQ*`Q A $, Q cP c  %0/0#8#8w !d0 P } /R 0Rpc Wp  *"M<+6؀: >c W \PUUK !  0c "$  ! 6! "$ 0    $("(!A $("(0 ("($,!   00 0$     Txjc@/Q Q Q  /L-p@P<ᐚ0`VF .0 a.hP3c 05HgixH85H$+<5  p`  ! Pp`  ! P R ` Ġ Ƞ,Ƞ ("(py`p _ p`ܐ+R"  $("( ("(B$ $("(P ("($,  R 갟 RCꘟ R= W: Y<0d/Y ^ p`+R 1 R }  Rw$ R C HE0T"EVcaX PU tx TP R   ,("( )) ^P\} \ p\ ؝x -)\PU )  !͟ Pp R R  R pp \PU  \P)p \ 䜟\! \ \} \  \ p p \PUP@QPa  R  ("(    ,B, 0Bu Zs )\pP\\HP U$  $ P  P  $"̠ ("$  ,$ 0 , (  $"< ("$0 ,$P ,0,0 B$0 $,0("(@DT@DH$H!B$ 14< X%X @@+R @H$H! 8 Rb  $"< ("$0 ,$0 , 80 B04#̠08#4 0<4 00< 08#88#8@DT@DH$H04#̠08#4 0<4 00< 0#88#8@DT@DH$H8#88#8@@;S @H$H"88#8@@;S @H$H4#<,Ġ0 Ġ0 ,  < Rp  $"< ("$0 ,$0 ؀:Ѐ 8 PT $0R@TT xЍL/L-MdP`0p 㶂@,( \> \ \ \g \  pరᲐᶒ రᲐᶒm\ pm\x\ \ ,@\  0-i  \ \  崰 `  Ġ Ƞ,Ƞ Ƞ,Ƞp 崰  `dh&h Ƞ,Ƞb㶂^㶂Ἒ\"  $("( ("(B$ $("(` ("($, &\ ꬛\6ꔛ\0 | d~0`+~]㶂ᴛ\ d6 \ h j0*j>u㖊,XE d `\ S ` S  & b & Ƞ,Ƞ  Hj` \} \4 hS4 X 8 _S8 XԙxX`VVo꬙ R) R& FS  `i` \} \ < .S< XxCX`V? S ` S  & b & Ƞ,Ƞ  h` \} \@ R@ X D RD X(xX`V 2\V#Vd ( (X d R6,B,` R H  R  H0  2 `V^ )\[,X d4 `w&嶂X܆  # L R P  R`d` ```c`b` 0 PL `Vt&t( B$  Ġ  ("(}  [ eR T  `R T \%V  V B tD0V/D  80P%pVl(䔟\  \ \ \J \ \ \> ԔXϙ@\9LĠ @DL @\0LĠ @DL @\'@ Ġ Ƞ,Ƞ Ƞ,ȠLĠ X Ġ Ƞ,Ƞ Ƞ,Ƞ Ġ X(L ȠLȠ 0 V LĠ A@DL H$HT \0` \ v㸈 LĠ A@DL H$HP \ 0 \0` u LĠ A@DL H$H䲟 \*В\ 0` \ wよ h Hpп0D"p LĠ A@DL H$HT \t \ 0`  R xR! B$  Ġ  H$H $"̠ ("$  ,$  , 0 R $(RL  L $  $  $"̠ ("$  ,$  , 0  $"̠ ("$  ,$  , 4  R  $  R $R* $ $  R $R}* $> 5  6؀Ѐ DXϙ@\9LĠ @DL @\0LĠ @DL @\'@ Ġ Ƞ,Ƞ Ƞ,ȠLĠ \ Ġ Ƞ,Ƞ Ƞ,Ƞ Ġ \L ȠLȠ 0   B$  Ġ  H$H  B$  Ġ  H$Hyp R R{ jP $" dP ("$ ]P ,$ VP , ("(("(@DT@DH$H EP $" ?P ("$ 8P ,$ 1P , "(("(@DT@DH$H($ ",( ,Ġ ( Ġ ( ̠ ("(("(@@+R @H$H($ ",( ,Ġ ( Ġ ( ̠ "(("(@@+R @H$H ( O  R  R RR  R  R  B$  Ġ  ("(@DT@DH$H B$  Ġ  ("(@@+R @H$H 8 Rb  $"̠ ("$  ,$  , 8  , ,Ġ  Ġ  ̠ Ƞ,Ƞ Ƞ,Ƞ @DT@DH$H , ,Ġ  Ġ  ̠ ,Ƞ Ƞ,Ƞ @DT@DH$HȠ,Ƞ Ƞ,Ƞ @@\ @H$H"Ƞ Ƞ,Ƞ @@\ @H$H,̠*  ,  < Rb  $"̠ ("$  ,$  , <  , ,Ġ  Ġ  ̠ Ƞ,Ƞ Ƞ,Ƞ @DT@DH$H , ,Ġ  Ġ  ̠ ,Ƞ Ƞ,Ƞ @DT@DH$HȠ,Ƞ Ƞ,Ƞ @@\ @H$H"Ƞ Ƞ,Ƞ @@\ @H$H,̠*  ,   RQ B"RMڸ RI  L L @а[ :а[1d尠J T尰 \,LĠ Ⲡ Ƞ,Ƞ @DT@DH$H @@\ @H$HԓLĠ ē尠 Ƞ,Ƞа а \ B$  Ġ  ("(!d B$  Ġ  ("(@DT@DH$H B$  Ġ  ("(@@+R @H$H R@  B$  Ġ  ("( 50 R1 B$  Ġ  ("(@DT@DH$H B$  Ġ  ("(@@+R @H$H  B$  Ġ  ("( z* "$  !ϠϠ J!  ("( "$ `   $("( ("(B$ $("(@ ("($, ("(pK$$ $     R 'd  d M @ M T1 \L`0 d R R d  MߍL/L-HM(, 048#808#8C4048#8@08#84< 0,X*k㗄(P( 0C21P 0E,`IV l \C0Sdd$V < OC0Sddd0 S Vt00S 02S ttddd00S 0S 0S 0S 0S t00t0d0 S @@p@0T:00S09S@p:013@0T:0,S@0T:lgpGW:048#8p@0T:0,S@0T:mL:0px'x@0T:00S09SD @ 0L0 00Lတ$$  0LĠ t| Ƞ,Ƞ +0@T  o040C40 Ġ 0C48#8p0C40 Ġ 008#804#̠08#4 0<4 00< 0 0000 8#80< #48#808 #88#8,̠ Ƞ,Ƞ H0պ0IB0@CT 00C0F 000A0,0#40, Ġ 08#80#40@@0!B0 0Jd0 S t00t0d0 S @@p@0T:00S09S@p9013@0T:0,S@0T:nbpGW9048#8p@0T:0,S@0T:oG90px'x@0T:00S09SD @0HP 0Kg ``````Fd`t|`h&h` 0P-,0@T p04p㷂 f(HЍL/,4<p@-@0P (o\ R gc㖂[`5V `V````VKo\: \2 \ \ \ \ 8Ο   +'Ο   --= p͟   p@/L-M`p   @  2 Q     Q  cPU8Q !,!  sQ  0!̠!    PU 0  PQ !,!  $ R [0@T K/I \(  5  ᜺ʟ0``  R g+ LH \<0``  R L 1  $ $"<$ ("$0$ ,$0$ ,   B R KR*K 0   0S:  x ЍL/@-  0P 0P P QQ @  @/p@-@`0ㄘ  QT:TKAT00C00PPT RS\ S \ З P RR ꘗS 㯀t R @4 @ `Mp@/p@-P`@@0 4?0S @Tp@/0@-Pᴖ@1? R@T0@/p$ RQ/0@-@P  =@ R 0@00@/@- Q Q㴕@TQ 刅@$5@T!@/L-P` A pLW @TjU $P U c R Z $ $ ROꈔ $04#̠$08#4 $0<4 $00< 0M0㣦1$ $"$ ("$$ ,$$ ,aO0S  <>0S @`0,00000(00303[0 0 4GXL@L/p@-P,@ U: U@TT! U U@0`V  F E   `!p@/L-hMPp   `  2@Q     Q  @T:Q !,!  \ 1  0!̠!     @T20 \)  ,l ,Ġ` Ġ` ̠$`cScH(084 ,1$Hz\ V H? \: \9 \ *\f ```( ,l( ,Ġ`( Ġ`( ̠` Vk 8> ]F```0 ,l0 ,Ġ`0 Ġ`0 ̠` V: x= ,    ` V \ ,000 S 0 <``LN\\GH0`V K/fE 5  0 p R }  $ $"<$ ("$0$ ,$0$ ,     B  R KR*K 0   0S:   fZ$ ,\$ ,ĠP$ ĠP$ ̠,̠$ ,\$ ,ĠP$ ĠP$ ̠,Ƞ $ ,\$ ,ĠP$ ĠP$ ̠,Ġ 0$ ,\$ ,ĠP$ ĠP$ ̠ 4⨴4  4   4   4  4  04 4 ␴ 4㾼hЍL/@-M  Q Ѝ@/L-M@p`\0PU K/zD@@5 @ @  ! !    ,  @600 @00 00 0000 0000  @V! R ; R|  @8 ;00@ 0 ; @@ @ DNP    Px6  ЍL/@-@H PᲲP @᭲넙 0ᨲ뀙 ᣲ먙 ឲ봙 ᙲ̙ ᔲ뼕 Ᏺ봕 ኲ됕 ᅲ( ဲ@/D-M`$0StwPH@mPU\iD QpD8 pA4:# p u t $ ,|$ ,Ġp$ Ġp$ ̠,̠$ ,|$ ,Ġp$ Ġp$ ̠,Ƞ $ ,|$ ,Ġp$ Ġp$ ̠,Ġ $ ,|$ ,Ġp$ Ġp$ ̠ 0 @T ЍD/@-(MP@4:㸱 ` hs `$ ,l$ ,Ġ`$ Ġ`$ ̠,̠$ ,l$ ,Ġ`$ Ġ`$ ̠,Ƞ $ ,l$ ,Ġ`$ Ġ`$ ̠,Ġ 0$ ,l$ ,Ġ`$ Ġ`$ ̠ L៱0 ,l0 ,Ġ`0 Ġ`0 ̠,̠$0 ,l0 ,Ġ`0 Ġ`0 ̠,Ƞ 0 ,l0 ,Ġ`0 Ġ`0 ̠,Ġ 0 ,l0 ,Ġ`0 Ġ`0 ̠ , ,l, ,Ġ`, Ġ`, ̠,̠, ,l, ,Ġ`, Ġ`, ̠,Ƞ , ,l, ,Ġ`, Ġ`, ̠tD<<@Dd LP`(H,Ġ , ,l, ,Ġ`, Ġ`, ̠ ( ,l( ,Ġ`( Ġ`( ̠,̠( ,l( ,Ġ`( Ġ`( ̠,Ƞ ( ,l( ,Ġ`( Ġ`( ̠,Ġ 0( ,l( ,Ġ`( Ġ`( ̠ ᮰ #! 0D ᣰ(Ѝ@/L- MP<`p@ 3F Z%   0000  0000  0000 $",08C4 0<4 00< 0!0B1(  0!0B1(  0R 0!0B1( 0 S0!0B1\(  0R D  d0 D  @00 @00 (00 (0000 (0000(  @ @300 @00 00 0000 0000  @ 7Z  T:A 00S 0Sb 0SB 0S| #0S0S0Sp!j!bZ@6 @      @px'xm@ @ 0 0  0  0@px'xO@ @ , ,  ,  ,@px'x100A1Q( 00A1Q @ 00A170 00@  0 00L1Dğ 07 @K[=Q0!!   @6 @      @Q@ @ 0 0  0  0@Q@ @ , ,  ,  ,@ T:@ @@  T: ЍL/@-쑟@$Q D RD Q Q D RD Q D Q DD@T@/D-@!B!`Q! Pp 0R W  ̀  0 BPp QU*@TD/N/0 S0S 0S000Q:/XH@-Q jP @/0@-0ጞ!̠|! h T  @ @TC P$604#̠08#4 읟0<4 ؝00< 0$0̝0(00,0崝0004 ?03030@00D00H0PD0 S @00L1L͟ 00D0@0S4-40@/L-MԜ Ĝ ᰜ ᜜  P| l X D  P:b ` ,L ,Ġ@ Ġ@ ̠\ ,̠H$D LD @L M0 @@I\ t@\` QP/   A( @Lps!("$,$ ,F PUa U\[0!̠!     @TC P504#̠08#4 0<4 00< 0$0왟0(00,0ԙ0004 >@DH DP\ @Q EhYD\\d)d p W` V8ЍL/@-0  壭@/@-鸘 $"<ᨘ ("$0ᔘ ,$0ဘ , x d $" p@ 00B S a B0RQ $@0  PU Q  0 NQЍ@/@-00 ?3@/@-*Q QꤐD@/@-ᄐ",8LQ ,8IQ 1Q Q,: Q!: Q %,$Q ,$7 Q   Q E@/0@-M@ሚ\  !tʟ 0 ,8 "T ,PU ,P8PPLU ,P8PPIU P "H,P8PPLU ,P8PPIU 啥;PPU PU PU4: PU 0-*'P U  G0,P PU , 7   0 $ 0@Ѝ0@/0@-M @Ș\  !ȟ 0 ,8W"T ,PU ,P8PPLU ,P8PPIU F"ePPUPUPU)QPUQ,(QP ,(57J  0 /A5 R, 8" Q(,(Q$ ,( 7,0Q ,06P 䖟0S 01Ɵ 0 ,08!Ѝ0@/L- M@pT ,\ ,8L\ ,8I\ !P\*8 R x!PPP Ġ Ƞ,Ƞ `P ` ` 0  ,8!^* Rs !nVT Rh !c`FpW pW 0SX 01ş 0 0Tk!N ppW-: pW pW: pW: #0 >:0 3`0 * %T" ,p4pW ,p4p`0 P P46\ 0   ЍL/L-M@`0px\  ,8!T ,PU ,P8PPLU ,P8PPIU  PPU&: PU PUPU  0OvP U , Q , 5PP,PPU $P(pUPP,pp0 5 p\ p 0   R R[. ,Q ,5 PP $` Q Q , Q , 5pP P$$ЍL/L-M@`pPἐ\ 0 ᤠ ,8T T ,Z ,8РLZ ,8РIZ C  Z ; }, Z* , 0  \htt,P\pxT, `,5pUppW  RE  ,08 ?PPUPUPU9: PU: PU% 2 0S)$@- ,Q ,4 , Q , 4ЍL/L-M@p` 0S  ,08l T ,0S ,0800LS ,0800IS , a0PS QY   S0S,0P,0PU 4PU0S= 0Sɟɟ 0 ,8x g0PPUPUPU*: PU: PU # 0l-D@ , Q , D41ЍL/0@-M@P\  ,08t%T ,\ ,8L\ ,8I\ 4% 0w  R R: , 8, R , 3     ,Ѝ0@/@-@, R , 8lT ,Q ,8LQ ,8IQ ,0Q Q Q Q &,(Q ,(3,(Q ,(3 , Q , 3@/p@-@P`p R , 80T , R , 8 LR , 8 IR ~ R*Q t P P0 0 ,8fPp@/@-M@\G: \: \: ?h,,(Q? ,(M39+,(Q0 ,(>3*, \ , 43   0 D+@ꈘ R  ,08$Ѝ@/@-M@P`\ \ \ ,\ ,2p$pUPPPPPPP,PPU. ,PPU* ,2PPPQHcPPPE`VPQ$cPPPEPPQ cPPPP`,PPU ,00 20   B  $ 7+P R  ,08hЍ@/L-MPp$` ,B@ L V a`LIV\   +  ! 0 ,8`IoV 00[  00|0 @00 @00 @0C400 @0000 @p @ @L400 @0 00  0D(, R   H,  ! 0 ,8`ЍL/8\|< HK@KHl@-0ϟ @0`d| 0h 0P@/ 0C4,8Ο   0 BS /0@-0P !͟ @  B R jhC 1 C"=  R FhThi-| R@ zChX R 0S b+h@|e0@/@-0p`d,PVl B}Hp R< 5p8Q)h@#8Q QQ Q !QBh@@ h@h@TX 680S00.000 80S0\\0\ 00!S00.040000.020000000 .hod@/L- M@PQt@*0pQ h=d ` Q |5d `@W8 R      B  B8 RPP R !R      B ,pPP0PP P !pJP  R  R  R R  R PP  R  @R*P ^PPRPPpGP^P00PR P0C400 P |  ~) R PGGUE.gh@ `0 %P1 ~R }R R* 0"`0 R }) R " ) R  ) R  PJZ% P~U }U U* %`0 R }e) % `)   X)  %B4% %  ş  "("(p% B$P~U }U U* %`0 R }5) % 0)   ()   B4  %  ğ  "("(p 4R Z~)Rwf0됔 Q:|@ ЍL/0@-@PQ  4Q<* 0@/p@-`#@R "PE  B   0C40 $,0   PE ! R ,R @,R  R* /R/ 5\ -*6D R 8  BD '& R   B4   7 w, 00Cp@/0@-P ! @  ~Q7D +RQڶ"1R Q 쑟 ԁQ Q  vN +R \}Q@  Q !d R @+R  @  !"RH   "Q@   R R 0 5 0 "@KPPKL0PlHh!Lpd$LH 0  " ""R Q x RM  H"R  R 0 " ""R R R/ 0 $3#" (B("50RTQ P  @$!   0@//p@-0 @ PERP`PPP@ P0PPp`PPP\@`P@@DR:0 > @LT00 op@/l?#P @-M 4#<,Ġ0 Ġ0 , 00"400"80", $$`Ѝ@/0@- 1C>0LΟ @LΟ P ,!B.+ @- @@0@/@-!B-@/@-!Bh-@/@-!B<-@/@-!B--@/@-0 0L2̟ 0@/@-!B,@/0-@ 0  @!\  0 !P $,4P P@  @! @P0/@     @ 000 @ /@-0@p!B* Lʟ PLʟ `   @(*Q   @ @Q  Z  VO @@ !,!   @!<00 @!800 @!400 @! !, !   @!<00 @!800 @!400 @`F + @ V @ @ @ B$  @   @@ @ `F 0 V+@@    @!,  @!(  @!$  @`F@0 V+@@    @!,  @!(  @!$  @`F@@@/p@-0@`!B%P Q [  0`FV@ @8#8Q Q@ @  @  @ $",8#4 <4  R @ @  @  @ $",8#4 <4  R 5 @ 0`FV@ @8#8QQ@! @ ! Qv@ @ Qm@ Qg. `FVa@ @QXQU@ @  @  @ $",8#4 <4  R5@. `FV/@ @Q&Q#@ @  @  @ $",8#4 <4  RV|p@/L- M@p1C 1`1C1P p( '0 0 00 Wv \q\npG@0@04@ 04@ 04@ 0,̠*  (KL@L!h@KpLL(L$L 0< 0 0@04@ 04@ 04@ 0*.  0< 000000\ 0  <0@ Z 00 N 00\ \F WC\@ pG@@ Ġ Ƞ,Ƞ@ Ƞ,ȠZ@@ S 0-S 0@00 0 S*0S000 00 0-S 07S0@000 0006 W400S00S-pG@0@04@ 04@ 04@ 0,̠*  0< 0?0\ 0  A X 0@Q WO00SK0SHpG@0@04@ 04@ 04@ 0,̠*  0< 0@>0\$ 0!   t j0@0@0 pGWJ\: \:n ~\ \     \ S0 00  S0000000@04@ 04@ 04@ 0,̠*  0< \ 0 0@04@ 04@ 04@ 0,̠H$D LD 0< Z 0@ 000S0000000@04@ 04@ 04@ 0,̠H$D LD 0< \ 0 000bnkSi0?00@04@ 04@ 04@ 0,̠H$D LD 0< \ 0 0?00@<@9S70@>00@04@ 04@ 04@ 0,̠H$D LD 0< \ 0 0@>0 @WW 0 S  l%? ЍL/L-@`00L1, 0P00L10 0p N%0ST 0^ 0 00 VU \P  [G`F@0@04@ 04@ 04@ 0,̠+  0< 0 S0 0@04@ 04@ 04@ 0,̠+  0< 0 S0000 5 0@ 00\+00V'0S$00`F@0@048#8@ 08#8 S0@ 0@0 Sy0@0 Ss0 000/ 0V, \'\$`F@0@04@ 04@ 04@ 0,̠+  0< 0 S@0?00@/ 0V, \'\$`F@0@04@ 04@ 04@ 0,̠H$D LD 0< 0 S 0@>0V0 S  ?$ L/L-4M(,$ 00 ( A D N P( A DN ( A DHN( A DXN ,`$  $,p@X\: \p@@庰Ằ I庰 \: \X: ~\ \ }t \ ps@ Ġ@ Ġ@ Ġ@ + .  ̠  y[ \pF \< [ @ [4p0X-@D , ,Ġ Ġ ̠ DxX|$ @,@,@,@ @ Ġ@ Ġ@ Ġ@ . !  ̠   X0 X 'p0X&@D , ,Ġ Ġ ̠@,,  @,(  @,$  @   \    \ p@ Ġ@ Ġ@ Ġ@ + .  ̠ 5  [ \pe \1 [ @ [)p0X"@D , ,Ġ Ġ ̠ @,@,@,@ 0 + R  \ \ p@ Ġ Ƞ,Ƞ @ + h 5 -\ 7\\ p 岰\@ [ p0X@D@@[ [p0X@D@@@|  \ p@ Ġ@ Ġ@ Ġ@ + .  ̠ j  [1 [ +p0X@D , ,Ġ  Ġ  ̠ @,@,@,@ nόi@ \ p^@ Ġ@ Ġ@ Ġ@ + .  ̠  d [1 [ +p0X-@D , ,Ġ  Ġ  ̠ @,@,@,@ @ΌpW0ƟW$Ɵ Ɵ W X!W 0X p X X ,`W X  ,` V  ! `X X@ =: 0X7\4 X ,``@@`@@ ,L ,Ġ@ Ġ@ ̠@`,\PP@`,XPP@`,TPP@` ,F$ X4ğ X$ğ ğ   ( D@ 4ЍL/p@-@!B#`!B#P~   Rs w  1 C!d3  RL` d Q Q Uu H B  0 Q4 8X R* .N 1 C!L2    R  1 C!2  ;Q W 1 C!1    %X R / 1 C!P1 @   XP@p@/p@-@, W 1 C!0 ` 1 C!0 P 1 C!0  !Bt  E vp@/,4D` <L(LpLXL( @-p!B.`!B.@!B.Pm p,m` @ @@ܝ @ @@@/@- 1C,=1 C!= 0     @/@-!B,@/@-M@ 㜜0:|0 Kd,X !B ,Ѝ@/@- 1C;Q !B+@/@-0 0L2˟ 0@/L-M@` p\: \:e \ | ~y \v@\ 0 WHPPKQ PP. PPNQPP%\PP PPNQPP%XPP PPNQPP%TPP P KT  P P P P0  8P ) ЍL/p@-`P@D R P  R* Q% 0  " P $("(@ P @H$HИ R   R Q   Ep@/@-@hQ  !B(k@/0@-MP@@D@ 0 A D  G@   A D  G Ѝ0@/0@-@!Bp'P}@P @X!B'P 0@/0-@@  @  00@  @@@ PP 0/0@-000L1 Ɵ 0@@ @PP@PP@PP@#PP@PP@@@  @PP@PP@PP@#PP@@% @PP@PP@PP@%PP@P%\PP@P%XPP@P%TPP@PP@ @PP@PP@P%\PP@P%XPP@P%TPP@PP@@ @PP@PP0 0@@0@@ A Q  0@/@-000L1ß 0@0@"  BR000S 0S0048#8 08#8@ß S00 S0@0   BR000S 0S0048#8 08#8Ÿ S0@1  BR{000Ss 0Sp0048#8 08#8$Ÿ Sa004 04 04 0 SL0"  BRF000S> 0S;004 04 04 0 S&0@  BR 000S 0S0  BR000Q QRTQ @/L-4M@PKM0M! HK(`M@KMiMHX##%<Pp1C`0`1C0 P% U#QQPE@@!p@px'x!QT Q*q" U QQPE@@ @  @  @     @ UQQPE@@!p@px'x@@@@   UQQPE@@!p@px'x  @( U&Q"QPE@@ @  @  @  @.  l3R @& U$Q QPE@@ @  @  @  @ UQ QPE@@@o UmQiQfPE@]@ @0PEUr00CRn!lϟ $Hl  ^ [Q9 X U RQ0 O@L@I F # B ? <Q 9 @6 @3Q 0 - *Q ' @$ @!Q@UU P @[  QQ Q 4ЍL/L- M@Pp@P`@P% U#QQPE@@! @ ("(!Q: Q ) U'Q#Q PE@@ @  @  @  Q Q @+ U)Q%Q"PE@@! @ ("(@p$)Q QtQ P \@@( % U#QQPE@@! @ ("()Q ,Q -@; U9Q5Q2PE@@! @ ("(@0@00@00@0*Qw Qs@(Q ) U'Q#Q PE@@ @  @  @  QFܛQ @ UQQ PE@@<Q  UQQ PE@圜Q 0U  P @Q ~Q D0 s ЍL/L-(M@$ 0 Q Eh] Q E\W A DM $  $ lp @X\: \ $\ 0p@P@ I \ Lf (x\(Ԟ\  \ p@ Ġ Ƞ,Ƞ `@ `h&h@\  \ *p X@D@PP@@@a긟\ 4 \ p@ T@ PT@ PT@ PȔ\ \ p X@D@``&l``@``&h``@``&d``@@@@@oPj\ z @p\\K*p XU@  @PT@I P`PEP P ```@DT @P@D  @P@P@ cP@NP@```P`@P bP@NP@@@@@ @ Ġ Ƞ,Ƞ `@ `h&h\\  XH\ \  \ @ \:@P\PP@갑\ @ \ p@ Ġ Ƞ,Ƞ `@ `h&h@ T@ PT@ PT@ P\   @\ p\  \ p@ T@ PT@ PTX|0PpMTh##%@ P@\ Ph  Up@D: P@%l``@%h``@%d``@@@1P,\ <@ \ p@ό<\ * \ p όꄑ\  p㨑\ WdßWXßTß PWX&W X p X X$WX $ X   X$I帒\ XPŸX@Ÿ<Ÿ <(ЍL/D-M@A A`PA`A Qꘑ pp0   Q( pp0   g ЍD/@-@ pE@/@-4 @/@-l @/$DM`M0M HK@-p @/@-T@/@/40,@/hmNA90ጁ\!: \ : P d\P eP <4 P /p@-P@`\- ̀\.: \:& \&:# \! $#\ \ \ L\ T 0 X PJP p@/@-0 ! @//@- @/p@-`@P@PEPp@/LP </ P /MT(pp@-@P Hg@ 0,ǟ 0@ p@/0@-@P  @"P@ v0@/D-@&Pu ` vph pzp `vpp a Df0 f( f,\C0ş 06S %@Q \ e`0 e 01ş 0xş01hş 0 4e01Hş 0 e@01 ş 001ş 0 sğ 0ğ  ,千HD!$ 88Q88Q Q< w!`$\$ !@$@$ ! $$$ !$$ !## !## !## ?!p## !P#l# !0#P# !#4# !"# !"" !"" K !p"  H"D/L-M@`p$dQ( | PEU  Q :Q =Q  Q PP \ ( 0 ỂU ͂ЍL/@- 寂@/0@-@|00S h0P00P000@00S 8141 0ᔁ0@/D-P`@ p Р   `` 0 rQ   D/iPK@KMMeC#MMM ܆(HL|x@- >>QE Q < ꨞQ  ㄎ@/0@-M@ Q E  X^P   A D  ,N 0 ~Ѝ0@/@-@t00Sp:S 0Sk:P 0S:J f801͟ 00S801͟ 0801͟ 00Sʌ-.8  0SJ $0 00 0T S@ 0 00 0, S*-8.$0 00 0䜟 S$*8̜00Q00⨜ S* 00 0S|,800 RJ@T@/0-&  P PX%X  @ @H$HPP AQ0/p@-@P `V 0 Pp@/(+!"0R P /L-M@`P@z\8 z 0 pW) @XLĠ @0 @ⲰK @Ⲱ \ 0  @Py \ V p8#800 @@@@A@@@@@ЍL/(8 RQ P/L-Mp@ lI0PU.00.`00p0000Sp 0S 0S L0S" B0SwT/II 0,0002 <02`0 Se0S_\.0S40@T,0002̖000 \000 0 0T 0I0202 <I?&04?l&00<2 `.000 0`H(I Q 0 0V~00F8#8LĠ 4< 08#80  00 0.F.APeQ Q U䔟eQX U 88PUЍL/L- M`P.P00.p@   e DQN 0 0@T0@00Z 0000@ N0@ 0@K 0@ Z 0 ~@@ @ @ @ !PDG; ЍL/L-$M@..P\*gLĠ `dl Ƞ,Ƞa\HW\ 8R `T0  \ p 0   \ C\d\W*\` # \ G4&\ pA\W G`\lp \ 㶁G0 0N5cdPK8NMMh@KL8,$Tt|L   pW 0  ᔠ }0ఐᶑ  O` VZF00S ^0S B0S  XЭ0S 0eS 0Sk@0S 0S 0S 0 Q0S@TT,]1S -M00S ^0S$ B0S/ 60S &GN0 X) 0 02< 002< 0D202002Hꨒ崒8 0,48F0S 001S 0S 0  F$ЍL/L-P@0\x @\PF 90C`````b``Ftpdl`h&h`,pp0C`L 00V* |00 0  Q 圔  cL/D-@0P.P0 0StF 0( Sx0@ S EcF n00.p0S f|` 0 S0 Z0S `VV Q00 S̕8%A l0l! 2801, 0P00 0 00 00 000 00 0000C40 Ġ 08#8 0 0  A  8ED/0@-P@TTLX@77,h7@8P0 X |A X$A<!B$' (0 @@0@/@-0 㴘QR   8 !8 00 QD@/D-M @u PUX@`<@?0 \y \1 p@00ᐩ 00C400p@00ḩ 000000@pGtpp0@pppp00z00zS4B0820   @`Tz \ <00D02 = RЍD/p@-P`h@8Q @TT8Q   V  p@/@- @/ᘛ8 R QQQQ : Q: / ,/@-04D@/@- -D@/@- &D@///p@-MPᤜ0SMz4Ȝ@.,00020 0 db \:z4”\ 4”@ŸP` @匘倈0p@/@-h R=0H @ T@TS  8  0 R@/@-MЗP娗@  B Rʐ7  `pP@@T@ (PU pQQ +'Q !Bt( Q8Q &``  V :&` `ธ  Vf*PaPFQiPP. `PqPGQ,yPP%\PP `PqPGQ\yPP%XPP `PqPGQyPP%TPP P a Fi P`` P`` P`` P (UPL0 Q E  `ZP   Q E  Z @TW>>@Ѝ@/@-0 A !J  E@/p@-@P0a01(k0 05p@/D- M@pCu ` !; P 1 C";   % 0 r0 r0 xr0 hr q G  | @s0 ,s $rr 1 C!\<  r 1 C!<  r 1 C!<  r 1 C!<   1 C!= !Pr 1 C!8=   1 C!\=  r 1 C!=  }r 1 C!= @ qr 1 C!=  er 1 C!>  XYr 1 C!D> @ ,Mr 1 C!t> @ Ar>r또 儐0p 4r\`p\2Lp- 0 $r$<\|4L@LMM`,L\ht$ 0pWtxpl0h q0| q뤖 \ VV儖 \ tƟpƟ 0 hqt ЍD/0@-@),&P$  o80@/@-0pP !` !@夕  u<;@Td0<00D0002``0$00$00 @/0@-@Pgr w:0@/0@-@PYr i,0@/@-@hP 4P |dw@/@-@ ,H@/@-@ >@/@-@# 3 * # !B#Gx@(@/p@-XPH@$#Q #Q~ "Q8!B"P!B"`!"Q Q:  Q QX4" 8" s:!Q7!B!PQ!!x! `!$ Q*!@!8! @To@p@/@-@ 0 00 !0 R  !t0 R@T@/, @Kh$5 |L(XiPK OKM 0@-P>@ P 0@/p@-P`>@0  $PP Pp@/@-0͟ 0@(Q QT@/@-@Q Q 9  Q G6@/@- R@/@-@Q!@/@- p,@QQQQ@/@- 0; @ R  R 2 R R  ( R "@/0@-PL@P P 4P P 0@/D-0@PZ0PT 9= 0p 0` 0048#8  0S $(Sx #0C@@T: @T: @T   @ Q@ & D/L-M@`P  0S 0S dU _0`p00PEU` T0`0 S:P0 tt  00t 0t $d0S  t0Sc Q0  `  *`0  %`0  ` o`dl $ЍL/D-M@`pP r R  Ri W R6 R/|UtSw `p `  PEU<Ei0 S:P0  a  00 1P,0( 0S !)Q#Q#0, L_L _0 ,L_0 ,L_L_  6QPU 00R R tzPYЍD/p@-@P` x R  R XzV 00,op@/p@-@P`  R lXV 00(p@/D-MPp(000 `01Tğ 00@JV < n #m0@0@0@0@#0@0@0@FĠ 0@ 0@0 ,q0@ 0 (j !P3 @ * ,2 ЍD/D-`MP`V3n/n0@01r000JT  n lp0p0p0 p0#p0p0⡠p0D p0  !1 0  `ߍD/@-P,`@?@T @ T: P p`APU:@/D-MPp$*000 `01 00@JV0  m ;l(0S D0 D4F@/L-HMpP`@00D0  \  8[ \ r 0Q h8@T T `8@DD ZUD Z  \\ @8 0 \@8⡠ 00 S@T< ldFQ Q 嘄ᬄSHЍL///@-@P`p\ D 0 w0S D0 .D F@/ 4ttTsOL- M`p(0@00 P  y \)0^ $p0   0\0S ,  X \L@ ЍL/L-M@  `,4Pp@?0 ` @TD L 0 @Tln@\*:6" + 0\ \: <\\&00 j @ 00  @+00  @ 0  @pu.T\o(D L\`\``V 000C 0s@D00 0SGЍL/L-M` 0. n PU$0  R tΟ   |d>d\`\ ,Ο  <0  ` PU͟(  (  \ \ \ m88m44 pm<<\͟(  ( t `0 N PU͟   , M0 ; PU̟   :0 ( PUx̟   'p P@/@-@xo@/@-@X,@/@-@8]@/@-@@/@-@K@/@-@@/@-@9@/@-@@/@-@x'@/@-@X@/@-@8@/@-@@/@-@w@/@-@n@/ ? A C E F G H I J K L O Q Y Z [ c d f g m n q `Lw0 Llc@QPLH(QL9Pp@/p@-@PU 9`LN L;@LaJᵐp@/p@-`P@'0 02tǟ 0QP@LT<TPp@/@-@C? \  3@/@-0P t@/@- CQ @/0@-P@ TL>,= R& Q %  "5  R  "5 0@/0@-@P Uh>(= Q$% Q % 4 R`>0@/$$ $$ t$x$ `h/D-~MP@`p@T /  / $0@ Xne n`@ dn/ ^n/ 6 "  Nn/ \ "  @\/^@ / //h/Nh@ /Jh /h/ \~ߍD/D-M`@Pp@T k/  {/ /@ Xq  qh  000 00 \@ dq/ @aq/ 6 "  Qq/ \ "  @\3/a@ C/ ?//t'/Qt@ 7/Mt 3/t/0h@@@@ \h #P TߍD/P 0 R:/L-M  @`pP.PPP0`0 000@Z:P@ .@p@ WhD @ H F- x, \| L8 QDX  :P/ Z V 00P000 IP. 0 P.P. <ЍL/0@-MTD 0S  >D  0S  =D r 0S  =`D e 0S  =0D X J 0S  =D K = 0S  =C > 0 0S  =C 1 . 0S  =pC $ ! 0S  =@C   0S  =C  0S  =B 0S  s=B 0S  f=B 0S  Y=PB 0S  L= B 0S  ?=A 0S  2=A ~0S  %=A ;0S  =`A .0S   =0A 0S  <A { 0S  <@ n @0S  <@ a 0S  <Ѝ0@/x0l$Hl4THL-M  0048P @ pW(  `VT㚌 @T8 ܕ\LZ 눕 䰄U  PU sތP\ddP PP PU QἌt$$H!ZX T<PD <따04(8(\|PP`` \,0  PU ဌa  PU pQ!  PU `A/ PU T5H PU H)Cτ$P㤂ᜒR\}Π㄂}ΠtR h&h Ƞ,ȠQ PЍL/L-Mpc /$@K?J/I$d0$E_$EόB?$EόA/$Eό@$Eό M  `: PZ R h)Q( W $ 0 @ 0 w@T 90 `%;` VߍL/   Q\# F@-M@0S v0S     < R ԝȍX!  RS \Ⱍ PU |px BTQ` ;0S 3Dc`V pW `pp 0  0 S 帜⬌84_0S !P | Ѝ@/@-M@P`!  R \,h PU 5Q .(Q '!Q !Q !Q D`V pW `pp 0 P` Q Ѝ@//   0R P7 PQ ,ԚP"Ě@Q* !  P ꈚ P* p P dPT@Q*X  @/@-v @/@-ؙ @/0@-vM@v/ 1 PU R@0 PU $F@0 PUt vl Q $D 0 S@0 PUZ@0 PUN̘} Q $ 0 Sx@0 PUp2_@0 PkU @0P᪸U @0P៸ Q vߍ0@/p@-P4y `@ ~ QD@T R  Ḗ R p@/L-MP7777P@ p` 0E @Dxб̱k_ $0 ,7`VЍL/@-@7777777%7@/@-lM @/@-LO @/0@-Mp 0@@ S @/ PU4;@/ P$0@  "0  R "Ȕ0  "ᬔ0   "ᐔ0  @| T  Q Ѝ0@/@-`ܓ p@ἓ P0$ Q@T@/@-P$7!77<h p@m `$ 0 T7@T@/@-@,6$666 66"6@/@-蒟M@/@-Ȓ@/0@-MM@M/ /PU'@/ PUTL@.PU(8@.PU8Q $@.PUd@. PUyh@. P UX @.Pɶ ,!UJ @.Pᾶ 0!G?4;484!44@/@-M@ Q*D PU RX,5ⲼQQ P⩼`pp\0`)5Ѝ@/%&&','L'''''p(((L)(,)(d((()    **<*)x**+0+**`++++, \,p,,,,,--,X---x-. .@- `.Q @ .Q 0Q9Q)@ Q,Q T@P !pP@0Q9Q.Q V @@/p@-0`P 3@@ .R 0R 9R\D#Dß T ,R @ R Up@/@-M @ P 0 R:Ѝ@/p@-P`LB0+S@ X@P`F P? @"z T V  @.00 `FRp@/p@-0P` @0+S -@P`F P @T!z T V  @.00 `FRp@/@-@ 3@P@/0@-@P0  50SU S0@/p@-P`@ ! / R@ ! Rp@/DQF. -0.8.@.L-M p`@`P@ ^: 00@ 01 01000@0T ̝y @T W \ ᘝR\00t0p 0$ ` @ D\ 01 00$ⴺ\`P @ TⰌV tVڠ pZ Qh c L)PZ Q O lZ Q ;  20 ᬛF0`V &@!01 00H 01 00$0 S01 000S00C䊟0 @T ЍL/@-鰚D@ؚ 嘚P@/@-p:@/@-@)Q x  0yQ @/p@-P8l10i1(f1ԙ`@ ᴙ0 V1@Tp@/@-@K1H1E1B1?1<1)81@/@-L@/@-蘟@/0@-LM< L0@@ S @V)PU ?o@I) PU2┹@=) P$⌹U @3)PH D U @()P= H  H  D  H ᠗Q LЍ0@/@- M@00004 `PHppDpp$pp0 x0PU Ѝ@/@-@L0D0<040,0$0'0@/@-d*@/@-D,@/0@-M 0@@ S @(PU}@( PUXp@( PU,d$ڸ@(PUXᔰD@v(PU$KᇰH@i( PU>Lⴸ@]( PU2l⨸@Q( P⠸U @G(P\ U @<(PQ    Q Ѝ0@/@- M@/x/p/h/`/X/P/H/@/\`P<pppppplppLp pHppDpp$pp0 /PU Ѝ@/@-@///|/t/l/d/\/T#T/@/@-T@/@-4!@/0@-M 0@@ S @' PUK@' PU?$@' PU`3η@w'Pጯ U @l'Pၯ U @a'Pv    ᴐQ Ѝ0@/L-MPt/l.d.\.T.<@O 3Q ?@d\T $ @/0@-@PT PU @|@0@/ᰘQ(ꌘ(倈/P#`QHQ(4$ (Q(( (QQ/̗$ R (Q/L-MP`㠗)@) p R @ R @ R+  9R 0R  0[0S  *h@ R R Ԫ `V 0R ` R Ǫ `V 0R `VT[*LX*@ R0P*8V I* @T @*l @TA4*  `$P R R * #*0d t*\c ЍL/@-@y) 0 ,$*\- 0  00C0R    $)R$)$)$ d @/0@-P @T8)  R 0 )0@/@- n@/L-McK@T`)``F`嶰 P␓10p0 p0 R P 00C P\   u* RQf XPU    ( 0 $[) RE눒$R)Q< ( TA*4QЍL/0@-鼑@(P (P Q 弑 Q Q $P븑$)@T@0@/ R (Q/p@-MP`ܐ@ܐ0d 8(Đd(0 (렐 (`V(0 ( d0 0 ( 0 ((@T (Ѝp@/zzzd:9 ::::;4:8;wd;h;t;;;;lf;<0<dK`< <<<<=(=L=L-Mp@P Ġ Ƞ,Ƞ` Ƞ,ȠLĠ`  Ġ Ƞ,Ƞ Ƞ,Ƞ Ġ   I Ġ Ƞ,Ƞ` Ƞ,ȠLĠ`  Ġ Ƞ,Ƞ Ƞ,Ƞ Ġ ㋱`  \T2  H @,t( #  X Ġ Ƞ,Ƞ Ƞ,Ƞ  Ġ Ƞ,Ƞ Ƞ,Ƞ ^  G @`V <ⴗ\0'1ZT p<<VTL'L_1A <<w 0 Sp-ҙؖQ&ߙ`ۙ00 P    ""  P㪙㿙0 0 00`00 0 000p G 0 0C0[ 001 p 0`p` 圕 t  @     P   !A `Z  X :Z`VV0`$t0-B 0Z0000N10000C0000X\ I 㛹000010 M! !A !0!Q  QY:88P    @   0    $("(0 ("(B$0 $("( ("($, ("(@P@  @+R   "$ 04< ("( "$ s㈘ \ h}ЍL/0@-,@@@ Q@LP  R  ఐ0R*00  0 PUL0@/@-@X<<P $8@/fL==4=t=h=x(op@-P0`^0S|@0 0 01@Q @TTf0 0 01/̷0 0 01Ο 0H 㩮0 0 01 0 0 01hdΟ0("(00 0 0 01,  QΟ0000 0 01`0 0 01Pi͟000͟0000Sp@/D-PDPN+AP $Ph<PP `AP `VV p!!l+ַ`Z[p ݶ 1 1 !; @/  @ 1 1 !: H>0@0@0@0@0@0 0 01Tʟ 000L01Hʟ 00 00D00 0 01ʟ 0 0 0 01ɟ 005bD/D- @Pp./0PU `EPC0`0@ ̠L̠0 յ@U@ DD/D-0` 0p:@0@08#8P0S2 00S@D08#8@?08#848#8 Ƞ,Ƞ 08#8 @0@08#8P00@S0 ᑵ00p0`0`.0SFD/@-117/'A@/@-霗P):0!!`'P !!4' P *!!'0QS@/0@-@P` P !!\&Pl $ REB  !ؕP$*ᬕP:c%%!!8% @T0@/45  /L-M@ ş000`0SPP0 0 01ğ 00 S 0 0 01dğ 00 S PUUN0 0 01ğ 0000C40 Ġ 08#8 Ƞ,Ƞ @x Š Ƞ,ȠLĠ pt| Ƞ,Ƞ<S0S 0S*0 0 01$ß 0D @ 0 0 01Ÿ 0Hs0@@㰀00S0@08#8?08#848#8@ Ƞ,Ƞ 08#80D8#8@\@ Ġ Ƞ,Ƞp@px'x Ƞ,Ƞp@ptx'x@Р * px'xW ,p@p|@Р p@Р p@Р p@Р *@. * ^H \ h\ 00 0 01 0R [0 0 01 01 0 㧳0 0 01h 00S< 1 1 !<0H  㚴000) 0S&f|q5ht==>>$> 1 1 !p0d  o000 0@ఐⰐ0 S: R  1 1 !0 00[ 2pЍL/p@-`P@ 1 1 !D1 H R @TT U @ 1 1 !P  1 1 !P*p@/@-M@ 00 \  1 1 !L Ѝ@/0@- M@P  /&0S @00000 00S 00S 0 ˲@@ T{0SG@00000 00S @0 0 01 01 00S' 01 00S 0 0 01 01 001 0 〲@ T@ Ts S n114Q QQS114/ղ0 0 01  0H 㲩!!L%0P%Ƞ,ȠlQ|%!!%  !!%@%%#0S Ѝ0@/p@-`@ 01Xş 01LU00 R0%4 dP2P@T딖 UT p@/@- MP `  @ q G w,̠ q G 8w,Ƞ  q G dw,Ġ 0 q G w ^ @T`VU @aah,̠aa,h,Ƞ aa\h,Ġ aah 0aahH   1 1 !8 @   1 1 !9 D  1 1 !89 0 !` T@TX 8댙 (| t 묙 ę  Ѝ@/@-@110:Q @TTN11|:/q 8#80P,X@/0//>>>>8>>T>?>>0?>ᬃᨓ夃//@-&p@/|/ h0QP///0@- @PU T P0@/@-@/@-P`p@ p00 00៺PU @/0@- M@PN  @ 0  @T  Ѝ0@/0@-MPA200 00000 0010  P$@l0U:U*XЍ0@/L-M@P0`4p8< p`  PЍL/@-M  QЍ@/  !0 $ Rh Q}/PHQ /pJ"5th6<5VC5J"  P聟//@-@P 갑@@/P|  !X1 R< Q8/ !1 R  ! 0 ! ̐@Q A✐ Q/0@-P@TT T 0 T@, T 00@/tD?t?X?@-@!Bnd\QP1C 0z @ R@/@-ؓPd꼓&o㬃@/@- @A0㐓0QQ|3p 0S   L!@  R8! R (  L! P   @!ἒP@/D-Pp@E `t UU`)0!0B1<  ఠ0!0B1  000!0B1  ⴥf 00A1ȑܮD/@⠑ PP@l/ @TPP@P@쐟/p@-M`P@& 1 C!ᴐ0  R UP 1 C!t0   1 C!P0 0 \@0 T <Ѝp@/???F0  !4 RQ/D-4M`P@d!x ? 0RT PULo!,  $!  !Ĕ ( p  ᘔ   t 8   P 4p q  (pD0$  @H$H 0R: 4ЍD/@-*@/@- @/0@-M@눓 | xp ld `X TL H@ <4 0( $ PU !0  !ؒ0 0 Pℒ UЍ0@/p@-M@눒T tX t`\ dL` T8d D$h 4,P }a F aa F a0a F a da F |aa F \a0a F @a \K00L1 0 8APUЍp@/@-@f R/,R#@//tKhK"KK|LLLL M0ML4LXL TMxMM OtPONpOMNNNOLNMNOPO@-Q >Q 8О̎ĞQʸ.꬞Q &ꌞQ kQ \|Xz뵖L /80$@/@-@T   @/@-fEF@/p@-M@/ AQQ ` A$P03C` U 000 000 00000 i@⸜TЍp@/ B$ 04< ("(    B / B$ 04< ("( B$ 04< ("(  $"< ("$0 ,$0 ,     B / 0C40$, ("(;R  B$ 04< ("( B$ 04< ("(    B /0@-@0LĠ PT\ Ƞ,Ƞ 0@/@-M 0`| :pQ\ ;QL 6Q< 1QT $ *@0 ! $   R  PPA T llP @/p@-M@$P(P,P``````@@ 0  xЍp@/L-Mp P  *Q  \P 嬚\:@`G\/  e`,\ $\ TpXL $0, $ \P0\ 尕p00 \P@H$H\:0@d10c0 ST 0X0 1  H00H00SD 0 1  x0H00#H0 0 1  ᨖ0080S-0 1  Ԗ00(0 1  000S 40  a  8`  QPU0@(@H$H|0Q: XUUHЍL/D- M@P`pQ**ᰠZZP*$0 $0  $00000   ЍD/L-M@P` p$(\h00<C000F >@T H,<48尓ᰔDpЍL/@-0  B(P@/@-@eԅ̕Q,e먅堕Pp  1 !`5 ! D  1 !,5 ! Q@/@-P 䔟eԄԔQ Ĕe㴄@/00AR1ᄔ0 R1l0QQP PP / @ܓR P P /L-Mp00P@QL'0  @H T0  R ! B ,`"T ЍL/L-M`p4P@Q`Q0Q 4Ek \ 0 ,0 \ s,  0 \ d\:Q PPU0 z@T0 @ ЍL/L-$M@`pP< Rs ,B,  tQ c 0S|[xPPP we10;:T  $  ( <  D       \p W0 0SA0 $ЍL/0@-P@Q 0 g0@/D-PM`pP@Q Pp (<D0  ?PЍD/0@-PQ*@"! e Q !ᬑ Qထ@H$Hd Q:0@/$",8#4 <4  RPPP /ᴐP圀ᔐ /M0 | PЍ/QHQ/tt"P@-D,@ 2 !5 @T@/0@-/@lP/0@/0@-PU / @(/0@/ -pP-}M@`Pd PU_  "%%R  #@@  02᠔$  RK R @@ t  ] 0 @OT0@ 00D0 S 0 \ P 샟䓟 @@ԓ 0  0Ңꬓ @夃 P圓 PP匓 0 x 0h }ߍp`/@-@R P P$,P ǸP P P@/@-@&@/@-M@Q'  R(   001Q  $ RQ Ѝ@/㬁/ᴑ嘁/@-、匑pdX L@4( $@/@-㳌 㪌ؐQĐ弐 尀 렐Q]@/@-M┐PlP tP\XTP  F]Ѝ@/ u 4PP<5l@-@ R  0S  ؓ BRQ@/@-@ R y^tm]@/@-@ R Y R WSN@/@- MP䒟 RA<봒@ ` VŸq Gr ,| ,Ġp Ġp ̠,̠ ,| ,Ġp Ġp ̠,Ƞ  ,| ,Ġp Ġp ̠,Ġ 0 ,| ,Ġp Ġp ̠ p` ,l ,Ġ` Ġ` ̠,̠ ,l ,Ġ` Ġ` ̠,Ƞ  ,l ,Ġ` Ġ` ̠,Ġ 0 ,l ,Ġ` Ġ` ̠ L@T] Ѝ@/QQRR(RdRRH4RLR@-@ 0S@|8y̏("(]@/RRL-p`XP@o@QTb000` p0Wl00Z 0 } @ї0՗ 00 ̠L̠ R:  B    P  ᶰ  R   00  u  ("(  PBh $ 0 0ݡǗP,44PPL/5 4@-`PpVIUQ@0  01 00S 0"01! W0S 0"01P! K0S"@TT0  01 0 `0  01 0 V001@p@/@-P`@ r tp  R @TT  B (@ P @/S \P. D.  8/D-@M@`P !? 1 0 S*0000 00~000-0  0`@R# 0 ppppp| p p pp 0R: y 0PES@ЍD/p@-@M@ 080 0<001?08S80cx0c 0  PPPPP\````hP````dP```PP0 S: 60 X X X X 0 S:@Ѝp@/p- 00 @@P ``PPjP , P``PPPjP@dJ@P``PPPjPǠ P `` PPP|jP0c5 0P ``PPPTjP , P``PPP,jP@dJ@P``PPPjPǠ P ``PPPiP0c5 0P `` PPPiP , P``$PPPiP@dJ@P``(PPPdiPǠ P ``,PPPTTU`UUTUUUUV؀4V(VHVVWV,WDWtWW`VWVV XWW0@-@,80P0"S 0E0C 0@"P@,P PUPP P0@//TuL-MP0,`0p @W   $  (  ,   $  (  ,Ib @` @ $` @ (` @ ,` @p @ $p @ (p @ ,p `&` p'  p  P  P*Ġ  P*Ƞ  P*̠    P  P+Ġ  P+Ƞ  P+̠ IX Xn  @p`\( H) pdTD8, @D |@D (p@D $p@D p@D l@D (`@D $`@D ` `&` p'  p )P P*P*P*P P+P+P+   $  (  ,   $  (  ,Id @` @ $` @ (` @ ,`` @p @ $p @ (p @ ,p  p  *  + P  P*Ġ  P*Ƞ  P*̠  P  P+Ġ  P+Ƞ  P+̠ IX Xk  @` @ $` @ (` @ ,`` @p @ $p @ (p @ ,p  p 6*+P\2  dT@,PE+ PE+PE+PE PE* PE*PE*PE p`ЍL/-@     0 0 0  0#" " 0# ",, ! #,,0!" "0#"#x 0#  ""X "0#!!0$p P " #0 0$4? @"à SP>@pRW `01,0100##.0,? LD+/,?  * @,)?   +`,-?   ,@#!?   *#%?   ,P#)?   *lp#-? 010 0#@$01,01 00##.0,? )/,?  *@,)?   +`,-?   ,@#!?   *`#%?   ,<P#)?   *p#-? 010 0#P%01,0100##.0,? (/,?  *x@,)?   +T`,-?   ,0@#!?   * #%?   ,P#)?   *p#-? 010 0#@$01,0100##.0,? PH'/,?  *$@,)?   +`,-?   ,@#!?   *#%?   ,P#)?   *pp#-? 010 0#P%` VY`01,0100##.0,? %/,?  *@,)?   +`,-?   ,x@#!?   *T#%?   ,0P#)?   * p#-? 010 0#@$01C,0100##.0,? $/,?  *h@,)?   +D`,-?   , @#!?   *#%?   ,P#)?   *p#-? 010 0#P%01C,01 00##.0,? <4#/,?  *@,)?   +`,-?   ,@#!?   *#%?   ,P#)?   *\p#-? 010 0#@$01C,0100##.0,? !/,?  *@,)?   +`,-?   ,p@#!?   *L#%?   ,(P#)?   *p#-? 010 0#P%`FVʤ.@.P$ 0@$P%$% 0P%@$%$l 0@$P%$%8#8P%@$%$0 0@$P%@P0P@ /3333UUUUb@- M+ 2@X ;  @dT㜋唛吋㈋@Xt+<d QXP+<@@<T$+ ,zϠϠ* 0-} Ѝ@/@- R  @//@- @TX Ւ@/@-P`*`V X * X:$0L0LHPUrw`IP.ؙQ ,CQ )A-.,CQ)QA-QA.0pX tPX@U@/@-0F\䘟0Xȟ 0X ۑⴈ@/@-0SLLX@ hȟXX@ XHȟ 0؈<A0@/P (<0SX 藟0Q/0@-P@J밗@Q< RQ T  \  0@/@-04 ,,@\ ,,@\ C\0 RS Ȗ R 嬆( R @/@-0 t Q<\Q R 00 ( "@/ 8Q Q0Q40Q/0Q*䕟0Q%:嘕,0, S ,0, S 3 S QR ,Q /-P@,̠h&d ld P\ P,̠h&d ld @L @LĠ bdl Ƞ,Ƞ l+`p`V `*pV *`V,`BV'<`4\VbsGtpⰣ pVbsGtpⲣ pV"ڤbsGtpⲣ pV cV bsGtpⰣ pVbsGtpⲣ pV`rV bpVz`rV bpVr@`d&|@`h&dp@`ldp@``l`Ua:D`d&|D`h&dpD`ldpD``l`UP`V$`V!H`d&|H`h&dpH`ldpH``l`T8:L`d&|L`h&dpL`ldpL``l`T'`V!H`d&|H`h&dpH`ldpH``l`T:L`d&|L`h&dpL`ldpL``l`T \./L/@Q(QP Q P /@-M 3  a  ᨀ2C !ᄀD@@(Q @TЍ@/`"p  HH R;!R> !P>  R6  !  !$>  R  !=  cQ PQ- l Z 0R4 3 !  !_ R   孨   {,   R Ѩ  哨$Ѝ@/@-@P 僨Q ( @/0@-@0P 0Q 夨0@/@-4M@ @" <"(  0 ㋰ RARd t;<"}/b<2H 00 R-@20@2<20<2@"0R:H !  R: !  R   R   R R | 94Ѝ@/@-M@ R  $,(40<8D@弙b QHbh 0R>XRN!R: !9  R2  !  !8  N R  !8 3Q Q!T(   QЍ@/ -- P0/    @R'4 ꌗ   R:  !Tǟ   R:@AAA "A!"BІ帖Ć /L-LM@HP [<"Q(!,(! ( (,!,,! , ,(!,(! ( (,!,,! , ,"`pl4h84 80s`pe`"ډ,0,D0H $($ (0DH[DHDHM 2” 0Cğ `B"2 B4   B "} R"2R( $"<( ("$0( ,$0( , ", $"<, ("$0, ,$0, , "( $"<( ("$0( ,$0( , ", $"<, ("$0, ,$0, , ""c`p@<  0`pڈ`"O<@ ܂ 0<@Ї<@<@ˆ 20A`A"A" zA"D"k ("A " " " " "  "!M Og LЍL/@-勃@/@-%Q vp/㳌?\ 2vP D<$ ( OQЀvdv%Q ~v@-M  >GЍ@/ooooop8ph\px-C6A'~l`5tpp /0@-@0PU Ô }\   3Jτ 0᥋  0@/@-@  #3Jτ 00㮤 R 303 30C 3 #R@//0@-@0PUŔ }\  5τ 0f0@/@-M@ d dd? " R%- 0d 㨣 R٤!  R 00ɟ 0Rɟ 9R R ɟ 3RhЍ@/0@-@PPq PjQ堤0@/p@-P$TCQ$VQ CQ R$BC@`@ Q  @,Q;Q @@` Vp@/@- 0S@/p@-M@ $ 0S0S$g x .|d 㼠0Q<Oh  & $ l &h张 RPx勡`V <Q V tPUU0S <4.0S ("0SP01 0 0SP0UQ}P `m L <c B Y 8 O .P01 0 ? P0U2 +Qa-P  QQ PJፋ R R Q2Ѝp@/@-txQ lQ @T0SD @TT  0@-@P萟Q  ̀R.嵀묀P0@/@-M  DЍ@/pppX`w`@5 q$q5LqXq0A $,!`A $,!p'0A $,!`A $,!p08#8`08#8pp`   ! ! ,̠`0 | .`ԈPPΈ!Ȉ!,̠@@ 0  "ЍL/p@-@  P01a00U!1  a~ 0S: lp@/D- M`@Pu Ȟ @ B~p01C40ⲡ 0 p00C40Ⲡ 0 U X ~ ЍD/@<hqqqq|#dhDl@5rP*|#rr(rH8rHr@r@-@ᤕ@/@-ᄕQt A 㙇dP B 㐇@A@/@-M000 0000E0001D000 0 D MЍ@/@-M0 000000D00 0 tD xx3pЍ@/@-@\$ Ά@<x8<A@<n<7@d胟-@ZăA P 010T:@D`3   H3F4 01T: 01@DŸ000 Q⼂ @/@-bO@/ FR-0L"0d"Ϡ  B\DŸ4 0  R "B"B!B 2 B1 " 2C/ἑ*R!⠑*2 C:0*  Lt  @ SR R RR/@-M  @ Q  @Ѝ@/@-M圐 A @ Q A @Ѝ@/</hlr00rP0p0x<`pp@-4M@P a0`X`,`a(`a$`` `````````` `@@@@@@ 0 ]|4Ѝp@/D-M@pQ |PxPQ l```X娠 ```P0 08|ЍD/H,rTsPs\sdsp@-P <$ |o 㼄@`xo@ Tp@/@-(M  00$0 00 0 00000000000000 000000000000  u(Ѝ@/5Pg|s@-/L..L L0 H  P后H@/pPXPHD/8H,/$H/@-M p1Q caЍ@/@-M@#@D `VZ RLR ]z? tPD !0 R< H 2 B2 !$=0 L !Z? "A", L0Z/)001pp000<0 0 pp p{P U{Ѝ@/D-8M`@pP <Q0Q A0 0 Z$Q pgZ fPU#wCQgV!B#iC000SCgF0 偃000pP4<Q.0Q*1C0 A0 0 Z 1C0$Q p gZ CC PUp8ЍD/@-MP`p@ z @%@  z@ z@ z,@| z @#B @TL1g-$fzkz2 X H? F? D?B?g] Gv  ,\ c? a X3  p+_ PUg(@@ ` v, ,<D,\,QfN pWn\ >> >> >$ЍL/L- M 0p@`P #L> @Tgu #=> pW>gu #.> Z>>gu u 0@ <` [ > >> wuPuPuPu #=X p> n>l>j>gTou \.+\ c7 a X, `$#L= PU! @@ p8u, ,<D,\, ~ `Vn\ >>>> > ЍL/ -pP- d\ d0S L\pQ 8s0 (\sQ Q  Q  RQ x44dd pr F R  !H A! !d !d $ (r0@00 G}Ѝp`/ -P-hM@` tQ \@M l0 S \@M l0 ShЍ`/ty zPz$z\zzzzzz zDz4zzz0@-P@ {0@/@/D-`@PorP#:Qg!B#:000SE;g|0 zPoq Gppጡ J 0q Gp q Gpq Gppጡ J 0q Gp q Gp0q Gp q Gpy0q Gp q Gp h 1 C!0 ( 1 C!0 (JP UD/@-@Q :Q :@/0@-@Pq 0S  0@/0@-@Pq0\ 0 q0@/0@-0@PT @ :q0@/@-iqP @/@-^qP @/@-  a@P0@ 0PPP @/%Q 00B S a B0RQ 0 @ R a@ PP /@- M`@P+ny p R&!,= pdxdddddddddddLLLLL L LLLLLL R!< e eee$e,e4e\ \\\\\|\|pphpp 0 L]pp    0 L  K Ѝ@/p@-`P0@0S0C@0C@DS P P `0p@/  0S00 S000 SAR/@-p0`P @0000000 00000 0S0@PE` 0PE @` t0S@PE`z0PE@`0S@C`@/@-Mp0`P @00000@00D0@ b0S6@PE`E0PE@`  0S 0PE@`(0PE@`S0SC@`Ѝ@/00S \ \0/  R00 S 00 S /@-P`p@@TQ oQ QP@@/@-P`p@@TQQQ%Q@P@/0-0 @ 000 00@08#8\:P0E PPPU@4< L0/L-MP`@pP nx@ T00:S00/S00 papGW0L p\0S00.S 00-S  T00:S@ 00KpWk0p p#y70@Tg# 0 w 00  QQ   7k7pPЍL/0-0Q aL\\+0@ PaPEU0@D PT\ +\ -\ .\ 0S:\S00/D-` P @ p  !#7 RgQ6.Q& T D/Q Q /Q@$.QQ /Q @V`F01PM7k$/Q`0100P@T:?Q#QT*P@T:'7D/D-p@`P0 NPU  P  Q/Q/Q P J0`V` I,$ ` J0N0Q /Q 0 S(#Qz{@d{{{{ {${({,{0{4{8{<{d@{D{H{L{P{T{X{d{l{\{lp{{0 J0D/0@-0P@@3 Bv3PCT0@/@- @R C6Q@/L- M`0p0,( @P{mwm sm  #  #u#p R RU #R EÕ R EÕ R# B#pGU UB #R? EÕ R9 EÕ R3  } R  R  p R g R R   }m RQ Q #y5 ##R \g!PC # #<0/ ##RQ C Q@ ЍL/@-HMP`p@P&  ኘ   0.0S  0 B00C0 0^HЍ@/@-HMP`p@P&  U  0 -0S x 0 B00C0 0sHЍ@/L-M`Pp@P@Ӱ [ G T 0 \ \ЍL/L-(M`pPJ @ Ǎ 0)  `Vy@ Rspq R%U#U 0 / $ 0 / $$R  klP QPPUpI#h4ÄÔ\ Jg_CÄÄϠ ^U^^ 0  + ##R R#L Rp R#PE#`#R #pW V #4 R g l  P <ЍL/@-M`P@pp 0 \ @D pPT Ѝ@/D-/i@T@#10S  @<PRЍ@/|0@-P@0) q) 00, , 0 0 4 4 8 8 <<0S H0@/@-pPA`h RV HHHH@! B!`H@T@/D-M`Qp@ h R@pHPUT T 4Q 4 QW HHHH@AЍD/D-M@pP` `H@TpP4Q 4 Q HHH@A8Q pPWTЍD/@-LM@ !H  H!LЍ@/p@-0P`@S @dOh R!dHh RATp@/p@-pMP`@U! Gh Q @KQ K9h8 K R HQATpЍp@/p@-pMP`@U! h Q @Q h8 R HgQATpЍp@/@-Q <"@/0@-@PHP0@T0@/@-@Q @T@/@-@@/0- 0   B   !  `  S  % OB   B   ! z/vOB _B   B   ! `!   B! b@   B   !$ z/!0S0/pԌ@-0@ R  R tR \@/p@-(M`@P -`g 0 Xg00 'g(Ѝp@/0@-M@g0P0E  Wg E 0 00 gPЍ0@/L-Mp@&g "g` g#/0P0 0(g 00 C0S@ T0KS/ЍL/p@-dM0`P @pf@T@<zf0PU 0E +oEp@/p@-`P@N R7 f R/  @LDL  0a0CS0@ 0PP  P @0PP @LDL%$f R f R  @LDL  P@LDLp@/0@-(M@P% < e4 f,ee e(Ѝ0@/@-8MP`p@e 0@T$0 f$000 e8Ѝ@/p@-,M`PX 00& @eed#C. @Tgeeeee G.,Ѝp@/@-BMp`Pc _e@ d[eK tWel7 0Qed#. @Tg+zeVeSedPeU te  0  he  0   P.Bߍ@/0@-M@PM PL eK D e?eeLee eЍ0@/p@-M`PR PdP  d)ed#- @Tg\eTdPdd d T.Ѝp@/@-`p@( PU P R  B@LDLPU@LDL@/D-M@P`p pddd r R  a @T dd!ddЍD/D-LMP#0@`p@`p   d`Vņ` dpdWd#, @Tᲆg m0S = R 0S"r^d0  0ᐆK-~ VQl"rEd0  0w2-e#|, ` 0a/HT0S!rz$d0  0--RB d d010100 0 n R[!RX 졖Z,,/Z c d?GR , cd#[, @ c0 +||"|`|(|||||||||||||||T} }H}\}}~L~`~~~\$(4t0 0& ,cQ  c0  0 #c0  0|,z,ễQ"ktc0  0ᦅa,#{+ ` 0H/0S\!kSc0  0B,@,၅q;c !a4c 0 m R/!R -cdG)c d?GR ,!cd#+ @c0  0! c0  0cQ M Hb0  0j++ \ k4b0  0V+LߍD//؀<X@-d`TAm@//@-@++@/@-@`Ppb##+   RgbpU @/0@-P#g+ @  Tg' R h& QQQ mbQ QQܜlČP+0@/@-ᤜ㘌w&@/@-M“P lPXXTP  /&Ѝ@/p@-P`#*0@TgY 0fp@/@-ċM@㸋+)(   <@;` 0㛁 0! R^)  R  `V)QDЍD/L-Mp #g(PUg'儓`V R-(@ 01_ 0100H@ T(ЍL/L-VMP@`0txq|U$_ ,N,___ ,A,_,;,_ ,4,_\U/`_X,_P,s_ 0, @, ,k_ ,,d_ ,,]_ , ,V_S_,,M_*U(h_,e_,A_ 0, x,,9_ <,,2_ (,,+_ (,,$_!_ ,,__VߍL/L-dM@Paq`o,؛HLPl  $05lL  D lt(D` āЁl [f #o't]#h']#a' t!R ]/ R ]/ Rgh^ \ Zp`P 0 t 0N  Jp`P 0 ]ύ < 0  7p`P 0 ]ύ]/`@t']']'DH#'t]d#'00t1S ]?00Sg/   p`P 0 t  0  p`P 0 ]ύ]/`A@tH']D'dߍL/L-^MP@aq圡R! #& RgU+^ p`0 L @ '<#&0 0 0Sg3ꠁX ` Pp`0 & @  0 zp`0  @ &^ߍL/L-cM@QaqRj H#H&` h#@& `#7&  !R `/ R `/ Rg] /p`P0  # p`P0 `ύ \ 0 L p`P0 `ύ`/ `@g&`c&`_&F#%`#%001S `?00Sg/ l \p`P0 e , 0 p`P0 `ύR`/ @&`&cߍL/D-bMP@`pᠡ<#%  Qg!`G00T81 H0 8 p` 0  @ %bߍD/L-^MP@`pᔡ嘱 #T%0 0 0Sg Z0 Up0  @ %^ߍL/D-bMP@`pᠡ #&%  Qg!0091 $0  p` 0  u@ |%bߍD/L-dM@Paq`4̂ [f #$t] #$] #$ t!R ]/ R ]/ Rg@\ | p`P 0 ta P @ p`P 0 ]ύO  0  p`P 0 ]ύ<]/`@t%]%]$D| #{$t] #t$00t1S ]?00Sg/ u  qp`P 0 t e 0  `p`P 0 ]ύ]/`@t$]$dߍL/0@$(`pTXԂȂ̂@-@` R p[PU [@/0@-MMPT-0@ @   p[ @[ R  @[ Rb @[PTP[ R  @X[ R< @ [P.*s[ R z @h[ Rk @Y[P Mߍ0@/@-M@4 M R  G R R Ѝ@/0@-@PT Z RZ0@/0@-@PT Z RZ0@/@-KMP`pZ @T= Z @T  Z R  Z0ptW 0  jlZ0@T 0G  Z0G 0 ,RPZ @T Z0pW 0G iZ G0 00AZpZ R Z R |Z @T _*ZpH}Z R <wZ R qZ @T ZpPKߍ@/0@-@P[  UZ R 2LZ R )xCZ R  X:Z R D4Z R +Z R %ZP 0@/0@-@PT Y RY0@/0@-MPp @\  @H R (PЍ0@/0@-MPQ$ Y R @T xYQ 1QQ.PYQ "QЍ0@/0@-@PT TY RFY0@/0@-@PT CY R5Y0@/0@-@PT .Y RP!Y0@/HH@<00  $ $(,/@-@    X|Xp_XdXXXLX@X0PX$X@/L-M@ "0P P T X R XzX  #! `` X p 2 C1 !0 X pWwX  RE P@` 2 C1 !0 cX 2 C1 !0 :BX   p@ X1  R !0 0b [2! @ TP U&! ލL/ , 8|<PDT\dhpL̃؃܃L0h\,p@-4M@L@4(   艟܉Љĉ㸉尉) ` { 0  RyL 80 B(0(ɟ 00x 0Sy  Ј  R  R  Rl^hT R L4 0SH'  `V R}y6jWh\\'0dG4 0  d_W0  䆟 0Ԗ@WԆȖQ&0d렖 ⌆d?V0X0L0S4640d$00000Y Ra @ ! R P$W0P̅PE  R PVPN0ᄅ01 0S* PV P<P| 0SPPV PL 0S P0P0000$ N PU R 8  R  P\  X$X0j崓ŝ뤓/Q #0dXxl`rP/\ 8.\ .\\ 蒟/\$#0d'븒}4Ѝp@/p@-HMP`@#-_ )_`A $,! t0QCM v RxX4>tQx,(2t Rw( t   0Rw  o 0 Qw 0R  0RHЍp@/@-0@!@0$8~Q($Q@/@-w@/@-M  bЍ@/|xtpl`H T(l| 8,|5. LpX \>  /////// >  //@--M/ R-M/ R"B T R 01͟ 00S 01t͟ 00S)[@/@- @-M/ R,-M/ RB@lT R @ !< RN2R-@///0@- P0p00Q lL TRR@ 90@T0 L004C40 Ġ 08#80]0S;;  $B$ 44< ("(ᰋ H 娋 %᠋  iTT吋T 0@/@-@p 0Q0E1P0k00\0S 0`00S L8#8P000S 0 *T0S00 0C40 Ġ 08#8G @T $B$ 44< ("(8 H 0 %(  TT @/L- M@0  L! Y  0S R 2 p  R  K("(P0  R d0 S R   H  R H K("(``  R `  x  R x {K,B,  R qK  p 0LĠ T\ Ƞ,Ƞ LĠ PT\ Ƞ,Ƞ  R  ЍL/@-@p 0Q0E1P0lg00\0S 0`00S K8#8P000S L0 CS0S00 0C40 Ġ 08#8 R @//@-0@ rP j@@/@-BM`@/N\@ 2 B2 !L6 dS R[ 2 B2 !6 R\MP8 2 B2 !50 !Z? 几  A   ş Zό Q `  A   <ş Zό 0 \ P rLr td U0 Д@TBߍ@/@-@p !P 2 B2 !p4 dR RA 2 B2 !84 H{R R3`& 2 B2 !30 !Z? afR Rp 2 B2 !30 !Z? #! ` 2 B2 !\3 d!VPUW 4a,e/ >RP@/Q Q Q: Q : Q Q  /D-M@" 0 !P  p 2 B2 !2 dHQ R 2 B2 !1 aQ R 2 B2 !1 z@Q` 2 B2 !x10  L!1PQ Rx  `_ 1 C!0 f 0S   J! 0 1 C!00 @/    = R  1 C!00 @/    - 1 C!00 "Hg  R%눘6Ѝ0@/@-M  GЍ@/@-\?@/@-8@/@-MOp.`X$,̠$,Ƞ 씟$,Ġ 0Ԕ$  ! 01ğ 0A0D1D00 ⸔1R NNN$倄D" tH"D*/d$$ X!xxNttNppNdhNddN $ $* $*/ 0d1 :σ01Zό 0A0D1C00 ;?d1R(+/N<+/dNP+/N`+/31p+/01+/;ß 03+/0`1h+/zNX+/NH+/N4+/N$+/{N ,/03,/03,,/4<?3@,2 0d1 \<Ÿ 01Zό 0A0D1B00 <pŸ 0d1Rt,T2 LN`,<2 dFN,$2 @N,2 (21 -1 01 -1 034-1 0`1L-1 z&Nd-1  N|-1 N-t1 N-\1 N H 4  !Ѝ@/ȋ(ċDԌ(@L.5T< P ğ0| .dX dK0S dN\  P \ğ0| |`:\  P  ğ0| pJ 2L2 3 12Llz?0JZ Z 0|#) 0\#!\ \ P 3 hX h\P 2 p 2L2 20`1W@TQߍL/L/," P/!Q PPe@/0@-@P - R  #P0@/0@-@P  R  P0@/PPc !0 R  c/ Q lc/PPc, Qc ԛ("xqj̑Ԍ0/p@-M@`  Tq  Rn  R:V  Rhh0Sb0S00l&JTWd#? P  II_\I/ 0 S IIPDIIh6500S: 0S `00l6`00l6`00l&T}.Q t _h6 Ѝp@/L0-@ PS Td!P P p0 @L!0/L- Mp`(@VD, P#@`p-0000@pU W p@01P@01p@01L@00 !0000@P@P ЍL/,p@-P`H0@0 0Y`kV p@/p@-M`@PH `G R2  R\@Mp l0 SP  R \@Mp l0 S~PU8`R$jЍp@/ᔒĒ@-U@/D-FM` 0 S 3g@Tj xȿ@ i P Uj 0ᵿ E T$% E"g0P0Uj$᛿rĔ$   hPUj ᅿ:$pဿpWX$   hPUxj j9$e<쓟$   hPU]j O9  hPUKj x=  hPU:j 8,D0D42 0"p2  004D. 0 iPUj [ XhPUi \T2.e9C. 00@.hPU iQ i Ӿ.U490000̑ 0C40⸑ PT\0 Ỿ눑 Q: dh P Ui PᦾpWz䐟$   gPUi ፾9iPUi PiPUi rFލD/,@ Rd4Dz R 01$A00 S! 1 ,z R@/0@-M@\ZPPPP P P PPPP 0,0PU  \@P<Ѝ0@/@-9/Q @/2h120ؖ@-@ 1 ! ? y@ZT@/@-PP=螟P؞@Ȟp@!.Q*!|.Y!X.Q*!4.P`@ZTQ!-8 yy@/p@-MP` @M\ !   匝  P` 00 # 0 0#0 0#0?00!010- ^yЍp@/@-@0  ,  " 00 " ?  1 !< Ty   @ZT0@/D-PMp 1 1 !9 `H 0AC\ 00"P F0." @=0"d  0@-@/L-@PT TUxۯl`a@r``Z^/`p` `a ``VO !!du`/11@1C101C10L 0S 1C\10LD 1C$1Z1C1 C@/PUmL/p@-PL@T @#T ^+x@a@FAd``@@D@@@/ @ u/p@/Tle$f$8D 7"ԗT", 00 0 000L08#80 000S009S/0  0L 0 0R 9R/-P 00 @@@ BQ 00CL BQ/p-P@T#P@D` V ` VT` V`` V@D@DT` V ` V ``P@p/L-M`00pPPL@@ 0R 9R e  ⿮36 KZ+  I   ~ Ġ Ƞ,Ƞ@ Ƞ,ȠLĠ@  Ġ Ƞ,Ƞ Ƞ,Ƞ Ġ  LD@ Ġ  Ƞ,Ƞ,Ġ  > ЍL/L-M`\@PPLP0@P<pPP\P4yUPPHP\ PERQ\PPpPPEL\4,HX6  5\(D4 a5\  \ D 0 0S00 S00000 S000 0  5 R    0R 9R    0R 9R R    AR ZR aR zR    R    0R 9R B<  0R  9R$n \" h 4\0 0000000 S $ 4\L 0 \LXm l 40S00000000 S  40SPp 40S'0 0000000 S 0C00000S0009S000.S 0 0000:S"  `4\ \ L@PP 0\ 9\ 0 \PX 0X @X @X( *@ W P PPRETPPX%XPPPRETPPX%X 0\  P%TP.XX)TT0 `ˬ`?40808 PI0@0U8 00,0I 0000000,,44048#808#8C4048#808#84< 0,40 Ġ 08#80#40@00@080 `00<@0SN @0$ 0 `w`30808 PIU8 <0,0I <00<0002,,44048#808#8C4048#808#84< 0,40 Ġ 08#80#40@00@080 `<0D<HX p,04 DE P@  @ y\ЍL/TGX|hȘp`x@-t @ <A 0Sa 04S04 ,:0@ @L ̠L̠0>S: >+ ?/Љ@/@-p@` VmꜙP<PAP P !0O@@0 @LP*@@@0LP* @LP*@@@0h0=LP * ?@00=PEP@/0@-`pp0V0C40 Ġ 08#810C40 Ġ 08#81 Q  (Ѝ@/0@-M@ Pl0C40PT\08#80   qЍ0@/@- @{(@/0@-M@ P  0S 0S  NЍ0@/0@-@P PlU_K(0@/0@-@PPYY0@/p@-M@P`Y R Y RY R wY( P( ?0SЍp@/@-@ 0tO0S:L 0k-@/@-@ 0R  ( R 0 B0 00NP@/L-@p`P00 , ,Ġ  Ġ  ̠ \LĠ ⺠ \LĠ Ⱐ \:LĠ Ⱐ \LĠ Ⱐ ᰠJ \LĠ Ⲡ \LĠ ⸠ \LĠ ⸠ \LĠ ⸠ \LĠ ⸠ \yLĠ ⸠ \nLĠ ⸠ \cLĠ ⸠ \XLĠ ⸠ \ MLĠ ⸠ \BLĠ ⸠ \7LĠ ⸠ \,LĠ ⸠ \!LĠ ⸠ \LĠ ⸠ \( LĠ ⸠ \㰠J ⰰ Z#A $,&000S! 500L 00 0+,P00C S*00C0 00,L/p@-@`P00 S00&0\000 0 04  up@/p@-@P 0`Fd`04<00S 0S  p@/D-`M@`0 0PETPpt|PUPPETPpt|PUPPETPpt|PUPPETPpt|PUPyPETPpt|PUPnPETPpt|PUPcPETPpt|PUPXPETPpt|PU PMPETPpt|P UPBPETPpt|P UP7PETPpt|P UP,PETPpt|P UP!PETPpt|P UPPETPpt|PU(P PETPpt|PUPPV*PETP04<`0Sz1Q04{D|4}x}~}D~~44444d1Pp0PW 0\YLĠ PT\ @\ 0?00 ^F Q? S; P0S70C40 Ġ 0@S 0.0S 0)000C40 Ġ 08#811C40 Ġ 08#8`M<+X{1@ 3\T@ 3PT 00S  }P  P  Q !, !   P  Ps 0 00 GPLs 00:00 6 PA04<!p | R R  R R 002   B$ 04< ("( !<!00~p` 0Ppp0U 01 0C40*  ? PA $,$0S  A04<! !,!  Q!,!  P `ߍD// /////ěԛ""弜/@-᠜Q눜? @-Mplh  Ѝ@/@- 0<$<Q   J Q   = ̛P㸋㰋㨋㠋㘋@/0@-P@TU\P@;;,;t@8P0 r2A $A!B* | (0 @@0@/0@- P@뤉圙PꄙPx0@/@-M@ ^넙08\ 0SSt Q&\\ JP P @ɟ @P`p P`p LĠ 24< 08#80 蘟0 mJЍ@/@- @/ᄘ8 R QQ Q : Q:/t,/@-0i@/@- i@/@- i@/@-pP `  R t Ri  804 S `F B`F@   8' "$  "$ 04< ("( "$ t "B$ t024< ("( "$  帖 $"<ᨖ ("$0ᔖ ,$0ဖ , 0S2 0R   $"<앟 ("$0ؕ ,$0ĕ , 032렕 唅 ̕ 包 5  t ,00 B  `\% `F@$ 02 02/' Ĕ@/D-P 1!A@Q'! !A !0!x$QQ @Q Q Q Q Q 11ᘓ Q/Rt /R`Q `! !A !0!!pu1!o1! h1 a100< 0 \`Fh&h J \*D S*Ϡ\v(Ϡ\q00 000 0C0` 048#808#8 S `VV W00 ST8!pA l0lp,:801( 0@00 0 000\00S 00 000 00 000 0 L/A  8Bh(L0D/"h" ā0N58|Tx2|2p2t28"@KiM0MeН <"0  L-yM@  p$ ]b&$ @N]&ld QHBPU(H`} R`l?0fl ! AQ A" 0S4| / /00I SH ˦8H,8  //0S / 蒟 / 0 $z$ 㨦0SV24#< LĠ0 Ġ0 ̠0 0 s` AQ Q Q Q Q  %䑟ܑ84묑 U/ `8+8L p`[ pWp`Z8+87004 A( =X  X  X`F 6yߍL/@-M  (D @ TEQG XFЍ@/@- ~G@/i<"hdxD""T@Q/-0@  )  P0S:\/hd`/0@- @H40($  옟 0!!00Q01X00\0Q01X00\hP 0 01Dȟ 00S@ 0@/@-'' ؗ'' '' ᨗ'' ᐗ'' xt'' TW@/@-L  @4 7 70770薟660Ж660Ḗ660ᘖ0  @/@-@d `6 X60L T6 P604 06 P602@/L-M`pP@㢠@'0  0 R: `p 0. RU 0@%00ꈕ0@5|0P%@ TЍL/-0!A 0# R(S /D-@0Ԕ\A꼔`尔 p夔嘔P@ S 0C0 {# R (  R  P \ 0C0 \# R P D/L-M`@PU B|P pPPdpXp/pX@%Hv@ T )0@0 , 4 RP P R: 5 M밒@@E㤂@/ЍL//p@-@T\.<P`/0PL@++82@0 +@%&@@ 0FR:@+@@E㴁@/p@/@-!+@/@-p@@ T#<\$P`/P( @  Fa  쐟@@E@/@/@-p@ᘐ`@ T/Pጐ @ | F: pP@@ED@/@/@@'3TUUUL@ ##9 <50 0 AQQ  B BP  ///p@-`PR .c0@T0 0.0 +.0F@T00.   ؐ   E x`p@/@-p@`P00S0D !QQ \ Q W 0< ll @//h5$5@"@- J뀐 t@//d@XL@</(//- 0 "0 @$AP:R/@-@/@-M0  w* Ѝ@/@- 0 " P:t " pd@/@-TP Q ,8 Q  @/᪻<5990M? 0>0 a"!  T ($@Dĸ?48L"@"h5$5ܞHgx ,le! $h!P ,!  0@M D8Xx!d! M"@/@-騐堀圐 #Q bl@/@-ML0 X<< @Ѝ@/|h =-P/@`UU@q@As@@T @q@As@pp@El@//-P/@`UU@q@As@@T @E@@Q@AR@PP//L-M@p,/P`TT PPQpPPU /(PPQ0 PP PQ P P PQ PP PQԡ PpQ@AQ@PP/ЍL/-@/P`T?T=PqPQ\qPPU4 PqPQ8qPPU PT$PPPqPQqPppPqPQpPppPqPQpPppPqPQpPp pQ@AP@PP//@- 0A01P@0@T @T @ Q" @/ Ё 0/AР 0/AР0/0x x ` /_-DP@P!+@U_^P" T"X"\"`"'5@-@@Q 0Q [$Q蓟Q̃@/@-3ß 0C  @/@-3ß 0C @/@- x /@T!/@/@-$@/@-@/@- M@&Q OI삟@  "0   "0w 圂aU0 0S |%xx 0S TX"X TT@$# Ѝ@/@-(嶆%0S 1  0S  ń ā$ @//@-\: \ 8 Q TЍ!!W@/@-\: \ Q 帍!!W@/@-k@/@- @/@-@R|y@/ 2$,0J \d"l"|JLx<y! PDT4PgM0N@-T@/~H "000C4?01 Ο 00S= 01͟ 000= ⴝR@/ 00C4 ? !t= 0 S 00 S R/0@-@PX ) !< ()U*K8+B,. @ -UP  U\ \D$<LLH@D0@/@-\M+ +帋 +夋) 㘋 "  ㈋ +| d p +d xx tt p`+$ |P;$0@;$0 0 l000000;0܊00Њ00Ċ00㸊00㬊0:0:00㰊<0㤊<0hp8:T04H00<0x:0:p:0`:0P:0 @:04ʟ0:(0 :(0:(0 :(0ɟ9<09<09<0 9<0ɟ x/0㰉7 ~/ 0㠉< 0㐉0 f/ 〉&|| xh "8 00QHH<)  .    x  ₋ T !00 10$ 1010 1d0㬈>>㠈?8唈?0㈈?0Ї10ć10㸇10㬇10㠇 10㔇10㈇148M?$8M? +7M? $70  04#̠08#4 0<4 00< 0000004#̠08#4 0<4 00< 00 <7M?00  MMMMMM/M0&     Q\Ѝ@//@-$M@       0 ⑌ 㿔$Ѝ@/L-MܕHpKԕ⼕ l ⨕  ☕ @ h5 D5l,H`4V`@P  4 B! _$$   GT$Z0$$ 0PU@THЍL/@-L 됓匃H@/@-N# t p# p X# @,t p@/`"R! R ! R"q R"q R 㤂 8 ,QPXP `X/@- M밑b봑Q M R 0v똑Aeh1M?  d0ᰁ0T0S0㘁0@0 0 002d 0 m@Tt0S] 040@ 0( 0H"l7<7Lah/ -LPP#@H`\pp5 @DT\ - h/"x3 p-LP`@y\ @P@/ < PPp$Qjph/h4x3 -L@ @Th/h" p-L@P ` @ +P Vr  YpPXPL x , VU +ph/"? p-L@7TPP- @ {P& #Q     ' @  AP Pೀ @ Pph/ -LGh/ -LM@PT : T* @ P* P @ PP        P  PPh/h" p-L@@PPХPph/ -LM@T9: T4* P0  + @  Q@  [ /V  QA Q @  @ h/h"4# -L0M@ T: TP*P0 \ uʰ [UA$Q@@_@DL@J "ea&aI @Dp\ pT  @L  T*>Ġ6@d`Č`@T* @D6Ġ`@d#XH0S2!P  B@ppW. p PW PEp@UP@@U?P ` U:` @ PE e004E <ŀ6%``OT2V@,z@$ @ 0[p0$0 T @G W2!`U`@P PE*0E `4"@`pV. P `V PE`@UP@@U?P p U:p @ PE e004E <ŀ7%ppOT2W@,j@@ 0 p00  ,(@P,0( @Pl/; 9 4#"ʰ0@-@ZPJP54:%A3@"@@QQQPER 0@ʠ \ l@.BJ@)C@LB !// -LLM@ $// 0 P`   *:u:@ B@0C@`,L,ČP̀UP̀UP̀`UP̀  `P @3# T2$呈 T3#(@T(52ᙈ(%P@Tᑈ2P ̀ @P3# T2$ f T3#$@T$5`f2$%@TU<@2 D@<DHP̀ \@3@#\@2 N,w\`3`#\@2@!`f`B\@2YPP@!`FāT`pV, ` @V @D`@T@P@T?@ p T:p P @D d 05T <Ā7pp_U2,jP4P8p84 pPRP0P,l/ -L 5 *?L B@ @ RR3!@h/ -L *5ʃ00όC? B@ @ RRీ<#@h/ -L :%/LϠ0C@0@ SS ీ S@@C  $0C2, @h/ -LM0L@S#8S#4LS#2LS#1LLL0 J *B500@l/ -Lt'@$l/ -L!@t'@$l/$@9J@A1@SA>1/ABR P/ -L 0 a 0 B 0 B 0 B B0Bh/ -LdMPL H04 8<삟 䒟 $(\    T^&  N   R: Pa$ R:$ P     ( ^( R* PI @@@ @ ` V@PL@D `X  <DP48< ^ `@T00@, P 0 Z  Q@,\H LP l/D<0( , 0J    -L$M  \\\ PP P  TP  < l/P " -L0 Th/ -L0 @ Ih/ -- L ?h/ -L 5h/ -L,h/ -L0 !h/ -Lh/ -L0  h/ -L0 h/- F: -L(\  6Ph/X "D -L@@h/ -LPh/ -Lh/ -Lqh/ -L`ph@^dPPUP 4P:Lh/4 0-L@<@=0h/4 -Lh/ -L`,BvPM    UP!UP@UP PLPUPB < <5  TL!pPPQ dPPdPPPdPAdPG YPE"RpGRF`V`pP` P`` UP V`FP U KG P ` l/  $Qr3m 0-L@Q_0h/ -LP h/ p-LPD@wP8,Q@A@ oph/4'3'4 -LP`p\@U@ dG@U p@Oh/ 0-L@0 0h/@- R* l\000Ѥ000 R& R R -PPPP RrPP B PP R  R00 B ] R000Ѥ000U\5 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA@/-0P RDHq B` P\"  `p@@@ @0\R P R/ -LPC 01 Q01Q01 Qh/ 0-LP@T T #!Q0h/ p-L@T T  T\\`aph/ -L@Th/ -L h/0 V4!R$:R!!RR!RR!R R"$Q0A Q0A Q0A Q0A Q0A Q0A Q0A Q0A R/-/4`BA3a" V4!R$:R!!RR!RR!R R"$Q0A Q0A Q0A Q0A Q0A Q0A Q0A Q0A R`"aB/-/ -L00@T1:T0SPh/ -L p$p$ph/ -LAAAh/ -L@P p āp āp Tpp āp āp Dl/ -L  !Ġ,Ġ,Ġ "Ġ,Ġ,Ġl//tftp server start err %d mac.datŴresdef.dat%imageoctetr wrbwbTFTP Server: got req while off TFTP Server: Bad mode %s in req Transfers currently disabled.Transfer refused.TFTP Serve: Ignoring req, too many connections TFTP Server: bad init opcode %u TFTP Server: session Alloc failed netasciiBad modeTFTP Server: UDP listen error TFTP server: couldn't open file TFTP Server: couldn't open file -KUnknown transfer IDFile already existsDisk fullSee textFile not foundAccess violationIllegal TFTP operationNo such userUDP send failedUDP alloc failedBad len (too short)short data from peerRcvd unexpected data block bogus tftp error textfile read errorUDP send failedUDP alloc failed Retry limit exceeded, giving upretry limit exceededzero length fileTransferred %lu bytes in %u.%u secondsrwrbwbSmurf Attack DetectPacket DroppedicmpInMsgs %lu icmpInErrors %lu In counters: DestUnreach %lu TimeExceed %lu ParmProb %lu SrcQuench %lu Redirect %lu Echo(ping) %lu EchoReps %lu icmpOutMsgs %lu icmpOutErrors %lu Out counts: DestUnreach %lu TimeExceed %lu ParmProb %lu ICMP layer stats: Timestmp %lu TStmpRep %lu AddrMasks %lu AddrMaskRep %lu O? dlink.di604Allocate packet buffer fail%02x-%02x-%02x-%02x-%02x-%02xPacket dropped by MAC FilterIP with zero length DetectPacket DroppedAuto reset TCP 113 sessionYESNOIP MIB statistics: Gateway: %s default TTL: %lu rcv: total: %lu header err: %lu address err: %lu rcv: unknown Protocls: %lu delivered: %lu send: total: %lu discarded: %lu No routes: %lu Routing; forwarded: %lu discarded: %lu Recvd fragments: %lu, Frames reassembled: %lu Pkts fragmented: %lu, Fragments sent: %lu, dropped: %lu Reasm.Timeouts: %lu, Reasm.Errors: %lu init error %d on net[%d] netclose: closing iface %s pktdemux: got null pktpktdemux: bad Iface type %d unable to initialize IPunable to initialize SNMP agentunable to find any working interfacesunable to initialize IP Multicastunable to initialize netunable to initialize arpunable to initialize TCPexit_hookbad net ptret_send: prepend%d) YNarp Requests In: %u, out: %u arp Replys In: %u, out: %u Currently no arp table entrys. %d %s 0x%02x %u.%u.%u.%u %lu %lu X) MAC Address iface pend flags IP ctime ltime %02x%02x%02x-%02x%02x%02x >In: Good: %lu No Port: %lu Bad: %lu Out: %lu UDP MIB dump: add_route: rejected null parm; dest: %lx, mask: %lx CLOSINGCLOSEDLISTENESTABLISHEDTIME_WAITSYN_SENTSYN_RCVDCLOSE_WAITFIN_WAIT_1LAST_ACKFIN_WAIT_2m_free: missingm_copy: bad lendtomtcpinitip_output: overflowtcp_out:mbuf-nbuftcpRtoAlgorithm %lu, tcpRtoMin %lu tcpOutSegs %lu, tcpRetransSegs %lu tcpRtoMax %lu, tcpMaxConn %lu tcpActiveOpens %lu, tcpPassiveOpens %lu tcpAttemptFails %lu, tcpEstabResets %lu tcpCurrEstab %lu, tcpInSegs %lu tcpInErrs %lu, tcpOutRsts %lu connections established: %lu, connections dropped: %lu delayed acks sent: %lu, conn. dropped in rxmt timeout: %lu segs where we tried to get rtt: %lu, times we succeeded: %lu connections initiated: %lu, connections accepted: %lu retransmit timeouts: %lu, persist timeouts: %lu keepalive timeouts: %lu, keepalive probes sent: %lu conns dropped in keepalive: %lu embryonic connections dropped: %lu, conn. closed (includes drops): %lu window probes sent: %lu, packets sent with URG only: %lu total packets sent: %lu, data packets sent: %lu data bytes sent: %lu, data packets retransmitted: %lu data bytes retransmitted: %lu, ack-only packets sent: %lu window update-only packets sent: %lu, control (SYN|FIN|RST) packets sent: %lu total packets received: %lu, packets received in sequence: %lu rcvd duplicate acks: %lu, rcvd acks for unsent data: %lu rcvd ack packets: %lu, bytes acked by rcvd acks: %lu packets rcvd after close: %lu, rcvd window probe packets: %lu rcvd window update packets: %lu rcvd predictive header hits; acks:%lu, data:%lu bytes received in sequence: %lu, packets received with ccksum errs: %lu packets received with bad offset: %lu, packets received too short: %lu duplicate-only packets received: %lu, duplicate-only bytes received: %lu packets with some duplicate data: %lu, dup. bytes in part-dup. packets: %lu out-of-order packets received: %lu, out-of-order bytes received: %lu packets with data after window: %lu, bytes rcvd after window: %lu ip_output appends: %lu, prepends: %lu, copies: %lu mfreeq: head:%p, tail:%p, len:%d, min:%d, max:%d mbuf allocs: %lu, frees: %lu mbufq: head:%p, tail:%p, len:%d, min:%d, max:%d m_copy copies: %lu, copied bytes: %lu m_copy clones: %lu, cloned bytes: %lu mbufs in use: type %d, pkt:%lx, data:%lx, len:%d No TCP sockets %lx, %u.%u.%u.%u, %u->%u, 0x%x, %u, %u, %ld, %ld, %s No socket TCP sock, fhost, ports, opts, rxbytes, txbytes, snd_una, snd_nxt, state: sorsndacceptsofreesoacceptsorecv 1sorecv:type %d not namsorecv 2sorecv 3 soisconnectedsbcomp:bad type %d sbcomp:badsbflushsbdroputcp_inputtcp_pulloutofbandDtcp_out: congested; snd_cwnd %u tcp_out- packet ptr underflow tcp_outputtcp_output REXMTvtcp_respond- packet ptr underflow tcp_usrreq5consoleHOST> Inet mainclock tickPING applicationsnmp agentnetmaintask create error inet startup error: %s Auto DialupTry to establish PPPoE lineSystem started%s - 2.10Fri, 22 Nov 2002dtrap(%d) - needs breakpoint [pktalloc : illegal pkt buffer address HTTP: open socket fail HTTP: bind error HTTP: setsockopt SO_REUSEADDR error GET HEADPOSTContent-Length:Not ImplementedBad RequestContent-Type:boundary=HTTP/1.0Authorization:multipart/form-data;If-Modified-Since:The web site is blocked by administrator/../../OKNot Found%s %s GMTFri, 22 Nov 200200:09:02Not ModifiedBasic WWW-Authenticate: Basic realm="%s"Unauthorized%d %s

%d %s

2.10%s Last-Modified: %s Server: Embedded HTTP Server %s Content-Length: %ld Connection: close %s %d %s Content-Type: %s application/octet-stream Content-transfer-encoding: binaryllllllmmmm(mm0m4mPmXmtmXm.htmltext/html.htm.xmltext/xml.gifimage/gif.jpgimage/jpeg.jpeg.jsapplication/x-javascript.binapplication/octet-stream.logHTTP: key pair error! Not ImplementedBad Requestfilename=.cgi.xmlHTTP Web Server open fail. B޿]kJ%xwb>2OA+r>Q ;e?[]\SaOg9.bz)8P1\w=S~߷[{3*$ڬk8a؟76n-RLFPɗ mWQH W!.+lz"& M!G0Ҙ:JJըچ3n,-:nS'oLe^oX p,_sE9 KBmī3ݓzHrSyV+|ڽ~`Cmʰ b^O^*mB{6xD`umzn4ǽ͞Heoe$O^ZZgnkdlI)lnZ@$9&&*\LyĤZsx u L)_f3Y[[cQu!J r!z죖/5j5{Ua5ԅ.NקP(e_c_=eXTVR:xdw5o,n_ .,҆A B#B&.ѤE&g9Kl/z<'5dB''z]:(zm7t?ԧO[JVoB#8U >)OLK{D=SS\4K Fx ?JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@1"}1!QaBCbr34 Q1Ra2r3s ?mP$Ÿũ[Hն2DsŊ5|@^`:kڅ$кZ:T{3f$;F:fXCUx/-2co4p_Γ3pj0af]_5$<JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@1 "!1Qa"RSAq2B#Tbr3s5C4%!QR1Aaq"2SB3 ?QbbiV<%29Gϋ̜hĬjDQ':/2Q, ԈENt^dY(Rؼ͋̔K$hSCoOiQ b^ަ7#".{htm/:FM^iDUYN~M^(J+=#|7ܝM^(J+=#|7ܝM^(J+=#|7ܝM^(J+=|7ܝU^(J+=#|7ܝU^(J+SC t0^w%L$ TKX*d{ru=n\Ys *\{raN\N}AN=:ָCڝL}ʞ*dP1y u׹9W4s`qEX_ۓM5ieݽ 1!X_CĎEWovޣ<)ϵ*dP1Sjr,늙]D}ڜJuuqNݸԼ]u*w0^qX^r|IjH.>G=47XYHFf%U7s'TT,Eǜ5/EvcC޵Sqw_be{n&dԅؐ1>X&DX-hWq+|)m._λgLUkUqeռ%֍.xw*̇ z. dlׂ6.ZG]jSH?iE,jQ>k"ık\+%vsX |_봑x_?vP0,UT#LcS/ N7,Q|=Ez1qRWܲ&O ②xZt-|XBiqi#ɛLMy}xM=@eDQ8?B]5Bqw( CxuCB49p=|3{vaf>iZY hMV*0]ˎYYq8mFXh8mWqGcD\Ȳ(-@, FJn{YjFJ#%jUW^pdw?R 0[X[ڲm*]b~rMhiEȌLo uDum+!y.ն[0u U >;)FlG(mTW,urEԋbFԍ#MMM0w(N iȵ"W EtR:7=a `b2SzBZ!iWw9x?7r}j/gu[9mù̡:Ԋ.<>N 'A ]Lv@R\|י,摭w8 *rbqعqn 14-؇7'؇7*چ`\./ŸW)`2vKXkfw $WO伲XŐ)ȓx؋7%0^OvszGyx`_&Z|ŝͅ./nǵx-%̦{e`]FI/suz{1zh|2$F~J6(ێ-ܹ_볓Z$፯i\|Zݘq-meb2 _iODpxZ )lmH(~SjߊXX#yuiP#]w H Of~*G/.⛅q6<:9*Cj~5slw0C9.ttծn}%'y~F102y%ˁ~ԖzFl\&Gl+yow%p>V߈!jz $u\Z^d,ۈ5t9@?4C7Oom E]h[JND4kA{` ;b[+1iw*l8sː{A5Ybx!H qŇ!7rbw)mbiGā^~C0 b} ܜWn]&wGrdQ{QzF7E&Qkr>KTI4]7GMV]%…o&.bCw%p>YbFZD-T6N@& 5h4+~kvff*b\vq} ܜXf/Cw,5c-%֭Zb⾊Whn^#`ኹ2Kҥ#هK кn+ڋ7/yj/Hܧ&Qkr>Kx @sq^^b]:L0V_}W7b8. -d~C^!%5[,?9'ܲmfkoBbUDAw4}Į:qJ\ .'b-\D񰶦hθzב G+:3[g$FcxvE\` {Ē2x[米sĮhR?MOl?'m~^A l/qpV|xf- ܲ|d8p4M!IͻDP6fIk7ô  b} ܜWn]EDD.`sOnFFq`]G7EWnSm*~܏"""""""""""""""""""""""""""B"""""""""DDRJFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@1"~ !1Aqs5Qr3S !1AQq"r3 ?҂bkwE4s7j7#3ڷQR9_SՈ`f9qgv-j&G-!^kf@cu2w\i&q%̡Zkf ^WGO":VaA;ir1*]@|"cFMvGN/?{|Pfq<mI hJFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@1"^s5!QA ??7O?~ _$1F( s[j?oo QJ Oj(51F((JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@9" !1Qaq"2RrS3$A#Bb!1AQaR"2bqr ?Ҩ*")&2r*04=UQG|2sR7/NaIbgoyW9 '0#|dDy<,=_ ԍKzh'1=_ ԍKz hO,;ki|2sR7/NaJN<xK)I=H49*;AiŘ^qMw/NaWcHˀxBXp5E,0+rD5L BTotqS_aqQ{B. fˣ{4U~Ж op@;6XLIA\)s K_#|tfZhj)d^7A B AqFFwŝaz*e&聜UDث #|pfs;V qkC]˳ ),Ƣ+.HEpZi:[^r΁9Gr|tfh{5JGjmYPֶ c]gf6k\d1ޥC-LUcޣe =ޤo .ٔG,Tбc4MqՀs&,I Y]/u\js~*d%oRiM KZqWaT I|4[xz0i+m&TkeWuY ^ߪjyvF˭ZmSwH n`ֵF ]e=bL$ʦ8ԮIPNT:>W40,{Lf2\Z`ۖ]#$ʍbL/N)3QSyk%c{Gִ4^  T!0I Ju2X*̹6}t'tosۤ@Ƈ7sR]y6ĒxʡI)(C)sg·+x{X k} ߞ9 ?Bƶ00,p6NDoҾ c f3)X%8)X+͊rv,y9cN✝?!b>)X%8'jOHrǘC< N)ړR#18BSrv1X)#sMX<] m0PY"JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@8" Q!21Aq"rc3TCS$aR!1AQaq"b#2RSr ?VReṕܷ(xo||(<~T~ʪxߨy?-\h$e:)S}?*6ws+_) v<~T~ʠq̛;9HOowSߡ<~Ug}2lO!>վN~ʛTɳ>+Vg;}?*oCPvws,:48 !>+'ڷ;)٨UR#kKm+Wo\Yq`tYȴ{dNf,8i#DXȡ_a*b}Ȣ*)V]98e,fg 3W3A']9@ |K]2MN}ɾ1w2[&\ô0Wʴ71 dii6}8> *$aT7S3HQ#YﻙH2F12Xa}swZYg"UH**j".նJY,Ͷ+7l7L<[ |b?d;H(]-CO3ca.Ԥ86lÕnĘo[+vQĮ9~Ae s|M{?d;OmD=y -hʱA$O, {MS2T#UeNؠG̵TUBaJة:XZdfFa*Vc  ,!8k0b2.vA?͋]g"O %aE SEs,:\j.Vjen2^ְ K$IVuV러mh uF-YQ sbdmxʨ/MK͗EjY徑]u`2G nՕ/:WH&܍?Uzm2^k\SfrqL@MČu@<#>G9ϙsO FP d6/Lz.LoW ī{ʇitxmeKK ep1t\9UV%zg3Eɔ7s_V6s3#jvJz3ZN&3?·+: \k} ΃9q ?"-kЋE\6 O$h6$2refwJ"XnOi;=ˢD֝l,Oi;9o.3Sqgt'6\Ҏ;=fwJ"skNE6]gttY҈ӷr A*m eDPFr^Q_JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@8" !R1AQaq2S4"r#$!1QaA"b#2q ?VY?«břՙڭIXl16sl16ƫfE@^"׫~wm&&Num&&U7M#wHprvٲbmdVٲbmeQ~ٿr:i0Gt~um&&Num&&U7MwH0zVٲbmdVٲbmeQ~ٿr:i0Gt~um&&Num&&U7^8QGM&pqέddr =ڹ{ޡ IK ajըE䈀0 sKM E(`DDIhoȔ /I Ei 蠎r gTmiV&&*afCSQOKˇ/Kà%aeY0~) rj%pcZ]puKà%ae1k%qaU {mcg4.9XeڏݴY[-j!^im@Pľ: _f@qI<# H&A7`z2xW@9R\HOV>P# q/'8هA"(N"c#vK**;kޛSAr J ϜKà=x2#KK\2րH @%g^MK@x.+nj\K"x%E /IMPĐsQ-YKI݈Huz5lk@'B^T/wF.b+֩M30'Ģf iVVxF<.1p?cvoz4ލI|DŊ,}Qo-F-fahRQ4.ZdLl)C;oFU:Kyp-kaoQww͚;2\$#SQz4ލP0I"H I 2Ohi"7G+Rm3-,l Oꯌ\XEY)5ҭ4ݥ2X"_JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@8" S!Q1Aaq2Rr"3#c$ !1a"Qb#AqR2r ?VSBmKj4Z2ARGߦ7G?ET [5e\=[S|% 9`h`8MX*"f2FLs7V7M>[S|#uR6iNE% S3!psXtmc0NhxTdgNj|!ڲv̆1L5-N^, s)91juzf-r_EZ+]Jc> jU'FxKXʅ{­-`a%cDm]3pؼ_Eܞ9dpZތR3x/TH/*b|c.iV+\-,pҢbZ cA=KDu#eL/kCkx~ggm'GKznĞؐkPVHIp*iٺ&:&YͳS*%Lo6xܛ"q_ݻ{bQ+/⦒v.͎4fPp~F5X#xZ!<$>ܳڹvI݉Ea4[nn],WfPîl/p#)\)4ϮVFV#81݉=۱&h'7w{ҡb^e3izB+g} aˀَЮ̼3}ñhaFxEZ?Sk.7d$\$%R]HX\));R|JKS5✞S>%'sDMx'>%'sOIwu"&SŸOIwu"&SŸOI:^)[)X 3YF"^rM7,QBJFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@<" !1Qa#q"RrTA23$B!1QaAq"#2rBRb ?e\睔:Y nSjoFSh>EJ&Fx$F-Sp` #ALĩe9j'Tr d%O88uJ8I\q0Ix &F>Vq'-Sp` )&`RO0847 ۚ,^ 9ı^5XEj*P/1C_(fw)VuS 9OS.RWT ̍]:aQ%JhtAҫ3䆚.'IZHB12"0۔A[qwzx4:QR==M%ְ[W4Xne<[!%, 1i Zz5M3vQ4(ht5;w`n\%ָ^]fݴJpiX._-SЭ<]ޞ qwzh4:TOL(j$&dT9ؘ}bתT@$`>.OJU,f(6PswPZV(w Hw \!ujgܰ!bHPo|} /DȺ ?m7>j/8BH\AJFR-MRh@\\dkH>+ kUO8cZ3XR.M~QFkdWdqx"IutuTZyt%6p#͜ Ih.z3|TٌuKL`|-&k.>Dꍣv>P-pmuYu+lQfs)z~eUQPIk7; \/6p#͜ AZYR6{Dg$Ybk 2I>v:{bEKچ,!YBj,Mk8T Hj\t=:/i~yngl˃i~y9o2n#l}?amG?Mɻlo?M鷙7mMӃQ鷙ӟ6&6ɿprJ>ӟ6#sdݶF7NIZM DI-604
     
 
Special Application
Special Application is used to run applications that require multiple connections.
  Enabled Disabled
Name
Trigger Port 
-
Trigger Type 
Public Port 

Public Type 

Special Applications List
  NAME Trigger Public  
 
       
       
       
       
       






     
DI-604
     
 
DMZ
DMZ (Demilitarized Zone) is used to allow a single computer on the LAN to be exposed to the Internet.
Enabled Disabled
IP Address  . . .
   
   
 
       
       
       
       
       

     
JFIFddDucky(Adobed     $$''$$53335;;;;;;;;;;  %% ## ((%%((22022;;;;;;;;;;8" !R1AQa"ғq2r4T#SBb!1a"bAQR#S3 ?V h3n ROE,v6`"Ѯ>58b[LE--ziYwY;VIn H18+yb[LE-(Mw'˂_y;E-&dؖMw&˂>/v+yb[LE-(Mw#}_V%ķ7̙b[Q7wuܛGC.Ⱦ7iحJ-no3%ķ7̢nu|E.v9GC.Ⱦ'iد7@ ӣeI`x @6çAorثV/7?.[iJtDEʕk ~5cP*+W 4b#-̠{WzS3 lg|"eC@ z%L\-/vc ;1nF]K?CtwUNj~Gw&cſ ;'TQPaXCE;\Ft|9FqN /WJ-ns, [*r@l13s1ߐnɘog8rZ\ӮƻlqT.=lsSn/0♒pz:W73sM;1ߐnɘ7%ϰ7X`q<~EWxrX}]1yKmXXE'60 h4@t\;+?qXWХxq{ 47b-@RWDDPH_o>PS񯷏FWJb66i^nƴ_gbK=k;ܽ)ҟT靂 4VRK4x% c,UP{es4ŤG'5"4-LϬ">wGR[ frXV־=9C4kt)_=>jOތ[t(WY/S]Fms>!kY?{ f r@4F,}h=ln ic Fvs; qc#e_;go/4Wik tF[/+.\}QMW@qZY]қs~&sf Mf5Vi4ek%{C&\-kzB]hckZшeMQmZ*;IĬp6m%kܤ9ĊRgj/ԥϊ?R_ub栰DE}3>aTT ]VMlP lWHoM+EUE+*qU.НYkUQbAwSyb짯u$m8ܦk6|ԏUCk溨mXaBKW(h[য়DH"Km&joM4uWrT8g2b6C)+gMh M{@Iv4Jg"49֗0ZOIY}95Ne+)k\ɖiWJp;1^UFQ8N/UkTH4^ᐩL DI-604
     
 
Filters
Filters are used to allow or deny LAN users from accessing the Internet.
IP Filters URL Blocking
MAC Filters Domain Blocking
 
IP Filters
Use IP Filters to deny LAN IP addresses access to the Internet.
Enabled Disabled
IP 
-
Port 
-
Protocol Type 
Schedule 
Always
  From time : to :
  day to
IP Filter List
  IP Range Protocol Schedule  
 
       
       
       
       
       













     
DI-604
     
 
Firewall Rules
Firewall Rules can be used to allow or deny traffic from passing through the DI-604.
  Enabled Disabled
Name 
Action 
Allow Deny
Interface IP Range Start IP Range End Protocol Port Range
Source 
Destination 
-
Schedule 
Always
  From time : to :
  day to
Firewall Rules List
  Action Name Source Destination Protocol  
 
       
       
       
       
       





     
DI-604
     
 
Filters
Filters are used to allow or deny LAN users from accessing the Internet.
IP Filters URL Blocking
MAC Filters Domain Blocking
 
URL Blocking
Block those URLs which contain keywords listed below.
Enabled Disabled
 
 
 
       
       
       
       
       









     
DI-604
     
 
Filters
Filters are used to allow or deny LAN users from accessing the Internet.
IP Filters URL Blocking
MAC Filters Domain Blocking
 
Domain Blocking
Disabled
Allow users to access all domains except "Blocked Domains"
Deny users to access all domains except "Permitted Domains"
 
Permitted Domains
 
 
Blocked Domains
 
 
 
 
       
       
       
       
       












     
DI-604
     
 
Filters
Filters are used to allow or deny LAN users from accessing the Internet.
IP Filters URL Blocking
MAC Filters Domain Blocking
MAC Filters
Use MAC address to allow or deny computers access to the network.
Disabled MAC Filters
Only allow computers with MAC address listed below to access the network
Only deny computer with MAC address listed below to access the network
Name 
MAC Address 
- - - - -
DHCP Client 
MAC Filter List
Name MAC Address  
 
       
       
       
       
       

 

 

 

 

 

 

 

 

 

 










     
JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@9"!QR1AqT"23aBr4#  !Q1a"2Bbcq#$ARr3s4 ?UW[DeѣWI:'6O< i*Mdg6<ɋ;( D mw_y`- ̲ ʎYͮ23]eA݁d veG uͮ2`n  veGuͮ2-q27%4ʟ uͮ2{.q. nR*8NH6<$`{kC!qcx|mhi:-'ţ[0:^ڼB(')ğ3(Bwא$yoo`IE-6{$lDމ"^`Ҽg8c7Ԩ A#e,d- D`]}˯.F.iurIJ+{XZp8iy7m(hB^ppàWgM5hN,"G]}bg#1ThGr.w4ݍtL \ҚiJ'PCdĞe<Ǘ_p\_ͮ}39WLj supEohdY s!`sE+Yv <Fyuܰ[Z4\I= RR_A8\)`d5= ]H '`..૚Wsl-c0xLnq+@廚Dؤu ہ¢JUՁ uȾ1&dK\}+A+{k? 4ڢ!t(I?I?< obF2F>7Lx-plvKU.亼 `V"GG56askC^! Bq`4!^!)'*άR -oyPo=؞B|,gRH7l^7lNW~K)Cb2t6'P+F~TSye7})#r7QmeIeW}(ʯ}SGnʒʯ}Q^P)Gy$9UF+(ցE |8ww!HB>GZ>!SIJFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@8"!1qTAQR3a"2brB4d !Qa1A"b#qBrS2Rs34 ?Vˑk yFJ|Oo;-JE}O{ͥ]TZZ]d<'RH *YT]ϕ9*Cu'^uٽ6vIͥ]SKYd<'R{!:]ghT]ϕ9*_Լ_Ԝ;B|ͥ]UײN_ԧ>i&Щy*siwWk>UsbVUQ"Z 8dҮP89OXF\9 9+4 V.[tpO0Kr쐁dV(V?LPwE7 4ҢpA\|ZH.V>+!xf Z g=O:ĸnjp[mF:3Q;b[]$73xl _nKr>@N_<;CɌcCqRK[.``uqKN%}-yk,2 u7SZ:ՁCap02JS垉bA3fJL*]7k.Bsrg\o|]Jyw@ X\#>N̵ZOwst^B$'8LXqLwғbɶLl9PVX:PG-hg14M6'}9GGl:tS:i'/q\k*ykcCCӆŮ4z###E8Xˉyz<|2([-L+\41%`|&%qhdkҪɱVsmxhԽO\IǗ"THZiDm|ϨsklE_Umh=bu%Sj H`,]x\j0VIfukNT"B *گ-0oboK5jEy S>e7>#r;UaIke^Cgbs~ZiA%16BӶ&Z^2 Bq-(@"21쯣t1L%?*<1iN2-sYۧmzTS/Zzm9ՈkKFDď*jiam֋sNTr' %ck?/aзs)UV ;]jXk*V*9vD&;UPpdLi cC[OW>"&ce|_JyұP6~]=ZgG(ƜDO - .5^[|aY;YRm ob+,E".sPl!\R0֙=OQ'Kky2wQSDvܞm&QSEOQrxSL)T.ۓ*S(gDGkFe^U{#oydrFV T4l`oLJڔK_JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@8" !1qQ2R3TA"rcSa4bC !1Qa"bAq2BR#$dr3s4 ?U7w,Zd RIE4O;>/*~ݲ@>>a9DkS+G;>/*#p Hڌ2xgjG@ԗյecc|^U5(cumO w|^UcjG@ԗYյEc>/*w<^UG5(6qR݊KmFYC?F'#kKk);i#k؎K[Gs$P7nMq34kXYaz( DYr?0unw.ڧ e\]_]un"k{fE 4ۚzlE QjkNt{{GJI6QB+a1G#쥜I 9H 3 sVO\/mIy\f +\wRc*{vJ< Ӎ2u+HY8͸֟we:B>wS >c>BPcxu!; B[ 8W:$$cX[qkY:Cs*~\F'7Jc2P@hSJ*UKMCC] 77Qui9W?^_+E)Z>75ol~mO_*Tq Mw܄  0D-?'eğYtonӛ/Ӳv`a%pOJ;lvOhgq dDD?n#Wwí46R[l6n%äs}KjcОgq M *"Q'{aөKo! mxu.q#˶+)@RLkAݖYtt.}S >c>BPOb! 0˒#"e++=u!f>4xOoy-QrEK~;QrE-Py?OGyj9^![床'(7G+=urC7QB?e>~rCܷQG,=u!~~# 4mEE ~AԁW]a@I,iÄ#Pt(W! ėJFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@<" Raq"!1A3SQ2rB$4 !1QaAq2Bb#$d"Rrs3C4 ?V2N$[RxJ;&FwMvM̙XK[m&rn`X~wFeMɰy]`*Yt7[#.vaOVa7;&FwMvM̨noFSkldgtd<ʎ] ݁GսNSkldgtd<ʆ_ ݁eKVa?;&FwMvM̨enh! <Ζ’G:&N# AHF#It;z}Դe1@!R%*xxO'pAvYdl} eJ J/A`ivp/|owsW?$tBVlۺRR0ǩ Ŝ+ow|g0lTw6[e]lv/=n#S[ |Uh-~ 6A"f7s%xvowsGGy*M4GR[_c!bu\L{]x׼qL!IIoYI'OJb}qXཿn:j~]{.==(ҎẪ{^?.=їbjqGpTv=~]{.==(ҎẨz{cF]{zQǥuQv)F#JqGpTv=~]mѫTdcJ¾ ӃufBY^;BjU DI-604
     
 
Virtual Server
Virtual Server is used to allow Internet users access to LAN services.
 
Enabled Disabled
Name
Private IP 
Protocol Type 
Private Port 
Public Port 

Schedule 
Always
  From time : to :
    day to
 
Virtual Servers List
  Name Private IP Protocol Schedule  
 
       
       
       
       
       




 

 

 

 


     

DI-604
 
 
JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@4$" A!1q"BQ2b#aRrCcD%!1QaA ?jmĨ}6%S6`8w{~.Jw{-&ɤGCWe|MQZh&e1TK} `i ]KKK+ZDgCCn@\t|C̼1vcɚ҂Պ N$YV T,!`:->tW%ӂލ* EHa T`A>QpfA\G#!Z$@"v; )Fi߻$\fVwfު( 9'OseJxqf}Q@A?-. Yq]=ldX\h袀?gzZ=Q@JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@43" !1Q"A2b#BaqR3Cc!A1Qa" ?ĠMQ(()`p)z'4d˹ !Oly R~AOT+bn,r13"j?I[VR]mIO?"s_.*RҤԞLeزU-?LU>㮨'fsFOEWY˻mWԵI0L56QNxy|AF* Q[cnop#2+Z%#di C mAi<0{D*z>bqeO%WR 1bLVYVTD5+*H@ Bj}C,%U ŲR+W&jwرqM d*qj +2H$OA 9,wsv i%\I⹫)̝6ԗX- [,-ЮG 5ʣzp^.rg>F=ٖst cs:זL?X{=WwN|ƭOHSLTQ3%w M}JO.VY=js ? DI-604
 
Saving Changes and Restarting.
   
   
   
GIF89aF####wvvGFFLJϕedd!,F#$dihlp,tmxOð0pH,dA@8ZجvV@0! tn|P7T #{  ML"òذL˟M ²̽~Cp  ;JFIFddDucky(Adobed     $$''$$53335;;;;;;;;;;  %% ## ((%%((22022;;;;;;;;;;K"!1AQaq"2RBb#3!1QA"2B3 ?0% BN$&Y8-DSnO(.u{ByMl2 9]1zSMJrxHAF$:IZ|W΄!eY5;`uƃA$ݶڐ\a~  ?RMBp_MGǶZ12UW[ۻMT `_z-}uFSgϪr+?Qݶݭݻa8#s>_ՖZS@]n:J!WOlj@Tj=9fkm`%Bι>@T"|ۑ$ LEͮ BP VsoykF?q}Ozۛh{ g87>eN=)t2y^pAľvWh Ԅcq1O SstAvt/_ҟ֗ R# Gt鳫 NM0f~N3Ȩ*򾐟}VqNGŠ2}w:Zό?.}O'ڻOxgu8F<#oU]ibYqvhҏDtY']&HosͻyŞfe5$eaBBdBt|Fiwn^:- +QA BkfsC"UD%BB JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@K"Z qs56Ѳ ?׽cg8Cmu%ޱ0H4@7ls 6s#P]qHC5azq0HCH9\R]9ޑs D!zwjk).5ah?JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@1"Aa3!1q2R Q2R!1Aar3s ?P nÚ m%_>=_K7"n vea/dElӌ ܴSY5W0:W3q)܏)_Ƣ]. ~ɬ{Mo;0eս2 GpJFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@1 "!1QђAa"RS2qb%Br#3$4!1QRAa"q2BSbrC ?QYǯ|V=~E2KYz>)wTu,dVz1F=~)X*ȬcNz>)S$UYǯ|SȦI`"я_:1sG_LVE;H]_^G$xV2А' %l^ԝD>I`Ԇ*DQ'>Rd :H>|>>Rd Ն,92KhCNt>jz<}kt>Sh7 1} 4])]+(> G(=jzW|<KPSaN=ONzSKXSaN=:Sң)C3aN ti)ȡY޼7Q z54 qS/IzJ$)⌭HUPuwoN. :su tPuqwoN.OPS{E9)ץ)CGޝL}zsSK\TȡcN>OIQQ2(z׎*J/EX_ۓM5ie 9BHN. GNx=jzT] ު.IQץ)CEޝT}zsSK\TȡcN>OIQQ2(ө:U4(늿rsEz5KlXTl@G+"0Tسoϲ;͹t< .ooZJѩ^"s @0FTw,H^u9,\NK*j͐E^]$vF;KU˳L6d7mՒ5VD-Ge!d1d lt'1ˌwޙa\G& \]ZMO[0vkkoyd-/Z[-A&\ 񴏪gK99\/,,,qkRY~g4.+h5fm ʵ- X哱ɍY 5IYZzZLilV:O[#^eH5JdJY5ԏ cs+9dWC)s$a`lZ |ڴVmckwk,ɭu z!{O/tEoI(N`gi-s Ў̪'Ō.0Aږʘ(\,fqqPd c` e{M+|>߱$1[@'&?weK}JJ[.Jhv $ U I3֨\M+!<޲10e3t,c{^X2+6Jag~+C }J9i!8,1mODQaU#.ce@ ]L*Bl}2AF!?fvOq=ð\i{E6?)70[YJ-ah{Ctu*6c2jw,d ܽ/mOK޾xerś}D6Cq v$wbVr]G{Sm#yKվP *9?w&؇Ո9ˀ/2v\`q\[F/\ɋEKn-L̡}H\ΊҴ(rfJe< ܧ6 >*U(iW;Ƽ!\(FTK6UWVw|P:wMo3ZNn{07rS(anN˭T95 9YlnlY,b`sdk1N 'f[[\_CLbT5}LهjS;Gr&\[hkeb];ׯG7ѼkVinڇZrv =6q ,+P7r~COm2TKcpfuLه=xWe\eCh\vy7RYj[Y ys0oÓּkw&ه_589̇kNAH>.K9ZmWCD2[;4]=#i*BS(90f@2j!=l7TeP&9@ /VMAsM%\C pֿ=d`b @[e< ܃#TPSzD~6&$ ϐ UEɋ*nm\7\Yb[1e~\-ܟضeGU\xI~\-ܼ'):"˚=dH\ V,y7N,KÓ07rS(anݹ .7'թ{<&ɷrQ0 ]fB-ٚߓ;@aqU2x{Gw,ck3{{:?u{2L+{騮)Z I-Jmi{07r~CG%߇Ƨ0fU(9,y b ե{Uvqsh#e2G(x+ּk ܣ6A]n)8#,Y͆_\CpA$WB.W w&,ۋHC\!zǒ.Wɋ+n?ضeGU\V lhwn.^pʲC#5z~V /`lˊaxn{07r':Sʹb:֟TijDw4l>WL13M+ep$:5ye$l+#P48viR}nU HgI+7\ô  UEɋ*nXDFVsjFFqrzY_ w&,ۋbi5OHDDE""DDDDDDDDPQJFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@1"} 1!AѲsQqr35 !1QAa2r ?3бh=9z7#-N[)/vW1 Z$z1ɹQCD#y^9Tޔb#X"[1J $ob /v/K oR_ΊFϩ8mZ kdA[dxIISkiԶ$8EjNbnlƜf^c&_+{G@(%Y%I1Y̡N l2g:|Þf{H hт)AuthqC#lO&=< G6 UРamt;GI0ZA\tQ{O.ks~#kVqb$Ev/4M ౠ+4};i*l5sn֐׍+Ly>a(`ޚ#Y T^C*xmEHiZ9ԢP;O $4X4 Fқ~m7j?:m3̗Wgw!  'Y*ꥉy "F|.Qi($ m*dk@ظN)B9w$K$S3#´4xZCe6YM?;!0$ay\m;$K2Fi˂2@I͍khaGdm'ED쨍`mS$ ,-bE$K̎ʙ$"0OqjvӆG+cvFF]d/$bS$KK5 rM@Иi(w*K׆g;U4j_jd+P+^nOμ2xCr!bAUNjee:XB6s5>+&KXvX/a7BڜG`=|V MЗڜG`=|V MЗڜG`=|V MЗڜG`=|V MЗڜmUאNEVԷ!JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@8"!1QSAaq"T32Bb#$4!ab1Q"#q2rAB3 ?h)]hzdRgݼMLO> g3wJisuoSR}Os3wJI-HjK|+7tLGV(|7Ԝ7Ԏަ}Os3wJtv5#|+7tLGV(|7Ԝ2GoSR>ϧςwJyb}Kgob;zz!% ;0+cMjGq6#檭2MCb%!\""E3#_㿡 @TO/%&Hٝ`ҐhvjVfWvfgږac:iN{@,7BFȖg?C5icڙH;2^W [Jo+ j>ǵ3Qv=<51:LMFY3[Ci<mWQԴX<l}jf {Wi\,LR,t\/ 9jcKx&!/mlRv* irf {S5icڦ^KMjVO+ j>ǵK&4kX̹ ̢o5Ps _>VKJ ̟^%w)8{BE/ U}gP4K|'/,Wia>DV.ke>Kz^Z>/Kz׎^e޵3 ƑоiP)]-+/Q+OZ-:ژoKhDBJtOA#wI uiZyy6'H{JiZ+ɱ:D5CVH{JDq^VM!ҵ:D5CV#rlN P!ҵWbtjN P,+ <>xt= 4ڷ J"J`/GIF89aƴ,8$ʙ;JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@8" !Q1Aq"RS2r4a#3 !1Qaq"2RbA3 ?ҮsL"ti+xu۝4}Rnq_ Ҧ`.8ٕts]u:KկIm'ɐm*˹ܻOőG#v*׌$6d6V܂n]'ȏث^3K N3K U[r w D}|Z_q_ҪܻM˹Y;ki|dIi|dJrAxh7H ##v*ݷ3O6h\r=׋Z[е}ʇ4WtRwJW|"JQw[s*5nt!gOVuu42{6N0ZO_UU"a0೩iDc**IKBA&K5`obq0jV&+9[Y*ˌ`ob`ob^5lE nPtT}T޴*$DpW@.;-+ZQo0j8 V)WlLl8AUwPno6wyi" -ZgwwJmP8 V'{e+ZEVi)1јV[s)"5[آ36nk$5 @.qʛmxkW'ܲ^6gZ>7[FҾQVEWu:^Bb9%sK+[i;:jdwG+Z1:\Ui*S&42cSZ}]kҷ-_2TKH H֍p<S&42cQG}4TIJW@jzS,F(-tV\IY$7r=-ہ6EdƞLi.m=Q2%7o : sA֋-Qz1 $j\wqCc^vEjm>:I,o e'ܸ+J>W"(+r QmSLؘl KKW?A=DD[Gs*|R q' "vFJ|R q' "-֍ΔOA=DD[)H1ǨzZ7:ScQ>)8nnt7(1sB,Qژ,"!5GIF89a 89:UXXCEFlop!, x0I8ͻ`(dihlp,tmx|pH,Ȥrl:ШtJZجvzxL.hY`n|N~ H !Ç#B("ŋ3bܨf#ǏC)$ɓ&S\%˗.cœ)&I8sɳϟ@ JѣH*]ʴӧPJJ*TXjʵׯ`ÊKٳhӪ]˶۷pʝK.;GIF89a8ƴ!,88$ɘ3uCI`$(:'Jz<ߵדsG2Q4O"ՙ.Я5LbT]xl8^ۍw*~x&d{wrnGy?|btJp} ;JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@8"!1QSAaq"T32Bb#$4!ab1Q"#q2rAB3 ?h)]hzdRgݼMLO> g3wJisuoSR}Os3wJI-HjK|+7tLGV(|7Ԝ7Ԏަ}Os3wJtv5#|+7tLGV(|7Ԝ2GoSR>ϧςwJyb}Kgob;zz!% ;0+cMjGq6#檭2MCb%!\""E3#_㿡 @TO/%&Hٝ`ҐhvjVfWvfgږac:iN{@,7BFȖg?C5icڙH;2^W [Jo+ j>ǵ3Qv=<51:LMFY3[Ci<mWQԴX<l}jf {Wi\,LR,t\/ 9jcKx&!/mlRv* irf {S5icڦ^KMjVO+ j>ǵK&4kX̹ ̢o5Ps _>VKJ ̟^%w)8{BE/ U}gP4K|'/,Wia>DV.ke>Kz^Z>/Kz׎^e޵3 ƑоiP)]-+/Q+OZ-:ژoKhDBJtOA#wI uiZyy6'H{JiZ+ɱ:D5CVH{JDq^VM!ҵ:D5CV#rlN P!ҵWbtjN P,+ <>xt= 4ڷ J"J`/JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@8" Q!1ARSTaq23sҁ"B#1Qab!Aq"#23 ?V9n"nW6VE'7ht[Tm\W;Qv ;Qv ^ej?PxO DiڎMiڎPve6eOR:+ӵW`ӵW`lx.Os;Qv ;Qv ̧̦R:+ӵW`ӵW`lx.Os;Qv ;Qv ̯ x.A:`H+y]y(G,jTOȗhdh.$; XŊBQIJ;U+6$Pl<SB@U -a-a$TֻAzMw,_"e_?Miܷ7S{+1LU2(O&!ֻbdĶ*A{yX9+nkXGN!Ia娪BYahq5V+?RbAk־R{`- <q[/bkau<J5CE w+69%$jiRg͒LK S͗4|VcgKJPN ZD@XiY4db,[` Vc])@k-{q(#s E{s=VP5+]O\WjDEU)9~U?l(6 %Y`fxJݡtcV1\Hёrfn!c(H-ŻBJ$$ZF!!h]3s+oj<%ikӁyns3ykoֿ2['v\Ա.gٗJ,(h>"(*`2F&ۙZy59:T ݡapPFRo[nО-x^d q,-N_ƫ*!iH]GF~^K_R /OLnD:t6DU t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD t6CLnD5ۿ?_ݮ܈$za~+w樨wG8'>wpN}P~Z"< s3Ԉ/3ԈRc1 wDyaDya)1&3Ԉ/3ԈRc1Mg^g儤0cR#R# I`07yGyG`"n=H,"=H,%&9DzXEzXJLs9"<"< swDyaDya)1&3Ԉ/3ԈRc1Mg^g儤0cR#R# I`07yGyG`"n=H,"=H,%&9DzXEzXJLs9"<"< swDyaDya)1&3Ԉ/3ԈRc1Mg^g儤0cR#R# I`07yGyG`"n=H,"=H,%&9DzXEzXJLs9"<"< swDyaDya)1&3Ԉ/3ԈRc1Mg^g儤0cR#R# I`07yGyG`"n=H,"=H,%&9DzXEzXJLs9"<"< swDyaDya)1&3Ԉ/3ԈRc1MgGGIF89annn錌!,>pl0 &U[UWBgNZDp+[Xm{xj..y1D^YFVW;GIF89annn鳳!,rx buPUUw}h٠*75[;`y+8(ZXf[a-W`n@J2Ća|izby ;JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@9" !R1AQ2rT"3aqCBb !1Q#Aaq"2Rb$dB34 ?{W!ֺ\~Zщ) Ǘ/;PKt$j0#~aOQ3H+6jޥò~*YYff2Y zU#ó5efq<5udO$&>O/G|j~`!tHI^J?V˪y R Al6 e*U7vpXXHùC=ӧ{$asjTƤAf3@nMmgck)-'갾J"kF-cF-ɑ9J9 JjKI,̯DhJXZ2o^xSHÃoՕ[X,|;åϧUmbƱS5$cԪ:<68x~ mfcGBGpSuE~/mbƱHgP3 8.LB`A\r>td\}/q!(FD9Qs&qr_'k8hI.%YU!Qb$GKW"mI;v.%O#@8mv,R<6fdp홓Gm;xmv3'GwH陑ofO!3#L̞B=#i#ofG AQƪw/k&ekr&ЏnfTloɽ|#YZ켽 //BnfTloɾ-|#YZl  &ݍN!9jk):MWRvHPha'[jḁ^ DŰHJ`DEzTP[~MP[~+'^[YxJli<4Y8-s9b)"ŨLJΗSΓ\o-դ-4"eEb@5jL4)y_QGyVx8Qeva˦{QW=̲1&H'-xn*\W|8lρ sO/U±JWw5vy$`7}N4QKQqrf# 3y Af䵬p o({q#Z!F!<{ER~_I'E\,j֧Q -v@0{Er{äI[-f&ׅ(U:sLO̠M}^ڿ;W".+V߼~ST+V߼~J (KEeDaڥ^Cŵ9 TڥT읉L8r;Xs+bh9u?֛M.Qk;8IjqoF ^*8ZXpU?H5މ1UJ؉y4&R*qXۮ;J1qs˜bM h?RvZ)q;ujVy?piWBomc*F"4k{F:PGM1?t2^(~kHlIb*G[;} yյlpk`5k9 ѳ!3TiZh7gJnG9e&L9J%}YjPm5эnVy+Z<պOlQUJA%5%b_=|S`%E 8iyE5lً3%;-RU36|hZIU'6*K'K{ Ǩ.]C[nǠ`S|d1n3Ee6+%T$LDr&%RN*ֵq"E"1t\zk>s:~2J?|@nU ԘuJpeGFݸۦOAkIQ1q%eE>5+bWV5bO_f٬8A+ek }ڱm_h}ڱmk%,8AdSJUM#zt7L+/{ZJFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@8" 12RS!Qb4Aqra"B#3!1aqQ"2R#c%Ar34b ?(H2='&S\vO[d. ՙ N@ =|{:wy pH-w(}w9>#J+|{:wy bzv(}wu"+|{:wy bzv(}wu"+|{:wy czv8}w:D>=;6LTͫ !:sCNF^'!У AbI+ʍGw|Qv-KɽB_ BLUQZD\[Ӊɽi\\w((qh2`#&E]&ɈDZr /wӉ˯^\I[&!L Z 1|z1pnv Z'ۣhknĐ;1bѭ2]!uHv]z/1zںZX䂌I,7 jV7hhᅓ>#&$hP9Xj ?z$;.4u둀Ũ:"1mn~ z'bQ,{HDkv.WA`T>jˁbL@RC*=2?XԷ_qYowR"-Tj=Gܯ*5/Us%N9Fg‡4U8MزܼX<*I4ts7HػT^iE敉J Ew'(e)q K$"M a-XvY09^$i"ӣ-ҷ"\^jBeTx#n#y54Pe Z4~=QYI501 *us`FMs}e?:o#zfܜ %0gvl(zhP#u&)M)I$܉'M_ŸQSP2+)~-'ZjdcGGNșEQ =2Xc*Kze|,""ګEF5- Xcky"(\T](eis^> x,u>Egi']SaSj vڛT{uQ)>xSfK7ڹS dP,T7Q vnv|T豅đ*y6 bB,ʱ}EYuqwy۞E[zpS:nyT] T] >қ™=T}ާn}7wL>cM|TȬMS\Pg2-gOi FuP"0Ngk+9(OѿxFai9(OѿxFai9(OѿxFai9(OѿxFai9(OѿxFai9/>vFƥ:r`r\L215=q]6|#0D\^)J f%ޭMbeF* 㜮5/";P]Z񸻋 /2p2AB[ԅؐ1>S;MQGݱ`㜫rᢖl≀PVVÌ{./is(ݟ^U ZFpaK)ڔb$@:S72*%8jnn\ 4=Uu~hE <̚G1ƀw|]+0𽧴Š! 63?/;mnvŒkxO`? Xu=<7EFߊI(OVK\4#.kˋ]+a}ԷZ[Se#.4HM~+1vW7pso|bWIxGR?rVç%6W~z@V隡 zu+T.&*Q+n*/`2aki޹vZfAgƪ.XjvO(#VOZXA]{ yXQ}+"g[ɚ vid%u7[?z[6͗8r"4i U-] 0+^E4$֍gttUyueE/fޮY~'QqH~Pj1pձw 3P6gIhbw^Eyxchk㱭+S}iخ#ks yx-v(G"pK!A) | c|OUfk̖rZHֻ%=-'9 - `&t_bKS{Z=ߊj=E[.|VƚZIc'd&gp"%K,Y ϒ\4_J[ޟ jtfKT̓b3u_GyxP\jmw6̸=ֶ T|ZKL2˪u$[66>هh{$*ޜDLN}B41>8fHZ#w>q2Mwm]#ڇC>#ľc2=|"{ۇp\m{E7VA͉70[YJ-ah{CgJoa*= XwgwKm:pZn(rm$M1<$wa`sVr]G{Sm#|85oWG 74q(~+u~B]pAbNqܹ \ɋEKn CR#3das;+J`t*b== V+5jj0Uw(R Z O5 llpb⺳{Ӻky{wT~ya74>>'q)S0: re-͋%;CLWllxѣ{6(!m51Tf.Nϑ]'ڇ${P[3w:W+DDhiWel#w77o`]+ڇ${P[o8s擶2n{uـ5B".hU+&{P[jK|n{M_\|_ 0XfC|>{ .<j+_zʒ; mdh6әаGZ] M,GK?(u :} $Oǫ3}iyVV@ɫmj$ N[;4]=@iwn44$bAc|xMF1S.z4M4Nt9ǴP~uF-(og7Io4>> ;"W[ƉGSU1 Hy 0 _IËt{O D+8q~^1^"|5#W(I4]1^f( +|`v2}q+ /&~]#ك%],GK3b[lebgOd9(x ״lYq3U[*b\`7WOCo8u]:}b؟ĺӽLUWJ Q]R*8bLT0jK|y2%2LfXɈ9,y q~ҽ Uvqkb}KWd3;"$vC_o1ȻcJ}i9!P\$7 SZهBq~>%qq6tlBwP,;j)2޾N1{zuoTe+%sz[Mp`'LY8Z\jߪ}WzjVA.nv=ֶ;m5Fݮ_L2-s`]_N޵кc̐" Ē >~>{/f-ݺtiܴܛ1ZM;PZ^A5 R4$>(aZ. [EFϛYzuo\2$\R!?_N ꨴhPQ""""""""""""""*"/JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@1"pB4QsRr!1q2rQ3 ?PwZMHqsN#mrxFI8< *1akrvyM ^bLɵˋ[fa[/;Iz~ˋ _ݻrqKFo 0JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@1"^s5!QA ??7O?~ _$1F( s[j?oo QJ Oj(51F((JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@9"R!1QaqSA24"b#5B3!1QAaqb#"2Bd%r34RS ?TNcOM [cl6w .xć4:7{DR.ܳKۑV'$\/x}Ĝ6i mI&);2Y3O`m մ7pT]DΖ&4@:5A-0++RB JgXү@lmJ>N˂;>bc˭2WR I 'ei๨vԺ"̛&YןbTfdK Zk@&wxpG'e~ygu9=-#SBC{1fUAEC2IamDԒ#k\?+G//6y./T:r(yv\Ip_&>믚:&SFꪙq 珖p<̠֬u]<]e |%6q;p1!OztE8Kz;.$(e9g.X'~'_~3%wVYбBګBQOX?($mo =/t߅Szg@hS_QfUв{Vqvm4t8t#68zԎ6: ju]jGAk5]MoZfGAWB=nH3\Q#qDQ֦P׶v>r֟ޜWS+L; ̗;U1F9Є!X DI-604
FAQs
Q1: I have problem connecting to the web-management interface.
  1. Check that the power light status of the DI-604 is on.
  2. Check that the link light status of the Ethernet port used by your computer is ON..
  3. Check your computer's network settings - verify that your TCP/IP settings are correct. In windows 95/98, you can type winipcfg in the DOS prompt. In windows XP/NT/2000, you can type ipconfig in the DOS prompt.
  4. Check to see that your computer's IP address is in the same network as the DI-604. The computer's IP address should be in the range from 192.168.0.2 to 192.168.0.254.
  5. Type http://192.168.0.1 in your browser's URL interface.
TOP>>
Q2: The DI-604 has successfully connected to the ISP (from the connection status shown in the Device Information screen) but I cannot surf the Internet.
  1. Check if your computer's IP settings are correct.
    a. Your computer's IP address should be in the range from 192.168.0.2 to 192.168.0.254.
    b. Your computer's network mask should be 255.255.255.0.
    c. Your computer's gateway should be 192.168.0.1 (The IP address of the DI-604).
    d. Your computer's DNS IP settings should be 192.168.0.1 (The IP address of the DI-604).
  2. Try to ping an existing Internet IP, ex: www.dlink.com.
TOP>>
Q3: The DI-604 has problems getting IP settings from the ISP
  1. Make sure that your Cable or DSL modem is connected properly.
  2. Try resetting your Cable or DSL modem by powering the modem off and on.
  3. If you are using Dynamic IP addressing, make sure that your Cable or DSL modem is DHCP capable.
  4. Some Internet Service Providers (ISP) require a MAC address to be registered with them. In this case, make sure you specify the correct WAN Ethernet MAC address required by the ISP under "Home" > "WAN" > "Dynamic IP address".
  5. If your connection is DSL and your ISP requires you to input username and password, then your connection is a PPPoE connection. To connect to the ISP's PPPoE server, you have to input your PPPoE username/password from "Home" > "WAN" > "PPPoE".
  6. If your connection is Cable and your ISP requires you to input a specific host computer name, you have to input the host computer name from "Home" > "WAN" > "Dynamic IP address".
TOP>>
Q4: If all else fails ,what can I do?
  1. Reset your cable modem or DSL modem by powering the unit off and on
  2. Reset the DI-604 back to factory default settings in "Tools" -> "System Settings".
  3. Configure the device with the "Setup Wizard".
TOP>>

Q5: Does the home internet gateway support PPP over Ethernet (PPPoE)
Yes, the router does support PPPoE. To setup PPPoE support:

  1. Enter the web-based management utility by typing "http://192.168.0.1" in your web browser's address line. Press Enter
  2. After logging in, go to "Home" -> "WAN" -> "PPPoE"
  3. Enter the username and password provided by your ISP.
  4. Click Apply to save the settings.
  5. Go to "Device Information" to ensure that PPPoE is enabled and that the status is connected.
TOP>>

Q6: How will I be notified of new firmware upgrades?
All new firmware will be posted on D-Link support website at http://support.dlink.com, where they can be downloaded for free.

TOP>>

Q7: Does it matter if I use a Dynamic IP address or Static IP address for my computer?
No, the DI-604 can be configured for either case. For Static IP address, you have to make sure of the following:
  1. The IP address is in the range from 192.168.0.2 to 192.168.0.254.
  2. The network mask is 255.255.255.0.
  3. The gateway is 192.168.0.1.
  4. The DNS server IP address is correctly setup.
    For dynamic IP setting, you can check if your computer has successfully acquired IP settings from the DI-604. We strongly recommend that your computer is setup to acquire IP settings from the DI-604 DHCP server.
TOP>>

Q8: Does the DI-604 support VPN?
Yes, the DI-604 supports VPN (PPTP pass-through and IPSec pass-through). The DI-604 supports multiple concurrent VPN sessions.


TOP>>

Q9: Does the DI-604 prevent hacker attacks?
Yes, DI-604 supports hacker attack logging and will be able to log most recent attacked hacker patterns. You can view the logs at "Status" -> "Log".


TOP>>

DI604
Advanced
Virtual Server
The device can be configured as a virtual server so that remote users accessing services such as Web or FTP services via the public (WAN) IP address can be automatically redirected to local servers in the LAN network. Depending on the requested service (TCP/UDP port number), the device redirects the external service request to the appropriate server within the LAN network. At the bottom of the screen, there are already defined well-known virtual services. To use them, click on the edit icon. You will only need to input the LAN IP address of the computer running the service and enable it.
Name - The name referencing the virtual service.

Private IP - The server computer in the LAN network that will be providing the virtual services.
Private Port - The port number of the service used by the Private IP computer.
Protocol Type - The protocol used for the virtual service.
Public Port - The port number on the WAN side that will be used to access the virtual service.
Schedule - The schedule of time when the virtual service will be enabled.

Example:
If you have a Web server that you wanted Internet users to access at all times, you would need to enable it. Web (HTTP) server is on LAN computer 192.168.0.25. HTTP uses port 80, TCP.

Name: Web Server
Private IP: 192.168.0.25
Protocol Type: TCP
Private Port: 80
Public Port: 80
Schedule: always


Click on this icon to edit the virtual service.
Click on this icon to delete the virtual service.
DMZ
If you have a computer that cannot run Internet applications properly from behind the device, then you can allow the computer to have unrestricted Internet access. Enter the IP address of that computer as a DMZ (Demilitarized Zone) host with unrestricted Internet access. Adding a client to the DMZ may expose that computer to a variety of security risks; so only use this option as a last resort.
 
Special Applications
Some applications require multiple connections, such as Internet gaming, video conferencing, Internet telephony and others. These applications have difficulties working through NAT (Network Address Translation). If you need to run applications that require multiple connections, specify the port normally associated with an application in the "Trigger Port" field, select the protocol type as TCP (Transmission Control Protocol) or UDP (User Datagram Protocol), then enter the public ports associated with the trigger port to open them for inbound traffic. At the bottom of the screen, there are already defined well-known special applications. To use them, click on the edit icon and enable the service.
Name - This is the name referencing the special application.
Trigger Port - This is the port used to trigger the application. It can be either a single port or a range of ports.
Trigger Type - This is the protocol used to trigger the special application.
Public Port - This is the port number on the WAN side that will be used to access the application. You may define a single port or a range of ports. You can use a comma to add multiple ports or port ranges.
Public Type - This is the protocol used for the special application.
 
Filters
Filters are used to deny or allow LAN computers from accessing the Internet. Within the local area network, the unit can be setup to deny Internet access to computers using the assigned IP or MAC addresses. The unit can also block users from accessing restricted web sites.
 
Filter - IP Filters
Use IP Filters to deny particular LAN IP addresses from accessing the Internet. You can deny specific port numbers or all ports for a specific IP address. The screen will display well-known ports that are defined. To use them, click on the edit icon. You will only need to input the LAN IP address(es) of the computer(s) that will be denied Internet access.
IP - The IP address of the LAN computer that will be denied access to the Internet. You can also add a range of IP addresses.
Port - The single port or port range that will be denied access to the Internet. If no port is specified, all ports will be denied access.
Protocol Type
- This is the protocol type that will be used with the Port that will be blocked.
Schedule - This is the schedule of time when the IP Filter will be enabled.
 
Filters - MAC Filters
Use MAC Filters to deny computers within the local area network from accessing the Internet. You can either manually add a MAC address or select the MAC address from the list of clients that are currently connected to the unit.
Select Only allow MAC address listed below to access Internet from LAN (Local Area Network) if you only want selected computers to have Internet access and all other computers not to have Internet access.
Select Only deny MAC address listed below to access Internet from LAN (Local Area Network) if you want all computers to have Internet access except the computers in the list.
Name: The name referencing the MAC filter.
MAC Address: The MAC address of the computer in the LAN (Local Area Network) to be used in the MAC filter table.
DHCP Client: DHCP clients will have their host name and MAC address listed here. You can select the client computer you want to add to the MAC filter and click Clone. This will automatically add that computer's MAC address to the MAC Address section
 
Filters - URL Blocking
URL Blocking is used to deny LAN computers from accessing specific web sites by its URL. A URL is a specially formatted text string that defines a location on the Internet. If any part of the URL contains the blocked word, the site will not be accessible. If any part of the URL contains the blocked word, the web page will not display.
 
Filters - Domain Blocking
Domain Blocking is used to deny computers within the LAN (Local Area Network) from accessing specific web sites by its URL (Uniform Resource Locator). A URL is a specially formatted text string that defines a location on the Internet. If any part of the URL contains the blocked word, the site will not be accessible and the web page will not be displayed.
Example:
If you wanted to block LAN users from any website containing a URL pertaining to shopping, you would need to enter "shopping" into the URL Blocking list. Sites like these will be denied access to LAN users because they contain the keyword in the URL.
http://www.yahoo.com/shopping/stores.html
http://www.msn.com/search/shopping-spree.html
 
Filters - Domain Blocking
Domain Blocking is used to deny or allow computers within the LAN (Local Area Network) from accessing specific domains on the Internet. Domain blocking will deny or allow all requests such as http and ftp to a specific domain.
Select Allow users to access all domains except "Blocked Domains" if you allow users to access all domains except the domains in the Blocked Domains list.
Select Deny users to access all domains except "Permitted Domains" if you only want users to access
Permitted Domains.

Example: If you want your children to only access particular sites, you would then choose Deny users to access all web sites except "Permitted Domains". Then enter in the domains you want your children to have access to.

  • Disney.com
  • Cartoons.com
  • DiscoveryChannel.com
 
Firewall Rules
Firewall Rules is an advance feature used to deny or allow traffic from passing through the device. It works in the same way as IP Filters with additional settings. You can create more detailed rules for the device. Please refer to the manual for more details and examples.
 
GIF89a G##$rrs  (!;3J(E\ܾYq<[nhxYekgrwϦȇًamq>}zo{|t9;;NPPEFFbccYZZfji010~~LO*oqVᴴyyymmm, GH*\ȰÇ#JHŋ3jȱǏ CIɓ(S\ɲ˗0cʜI͛8sɳϟ@ JѣH*]ʴӧPJJիXjʵׯ`g2 0L`Y8L@h-'^ 8[f1en`y ӦY9vHfg=[&ḫ-Cl3_椩L/9zAsk^msw4_mW^{>iA ݗ/&x]1c[Y4POm ݃;4/c w<hs<@93\-=S@ 3d49s L˅\tS["v3yl}~hT&R2Ap4gGxÎz<*/Ep ޳,29%^XsP~w@<2#~$8Mm-T(oLc.L .L˧W eJ1kЗlϚz+,(6Xb~ϤU' R,"w C*-} 1. 0< .LznQA[R2'5PK? b")[Cb-B.<Xl]C2,DJ-}@H/"P2'D= !sBw6! `J@)4qɜpbK{@<13?|HB;]>S1uO6|05!K(̍첬,G?P~g_ѕK BaEaVx`ab`8 BD)JH Bl,$A ĆYhNsw[zÓG|" P c$8!{bD' V8"0.z!@bvip a".R 2 U iCۦ?̜K|v g[*{S| l[1W!")K0` I`""r!"LM: o j#JhNА@RX#5#xQ])y٨q M (@{Ԥ# Fa0 D^: "E.r1M|dE)b3@{8B`p{ UdP*1 _K/hcr̀UYt0vDyӽ4`Ɏ5즛9Ϣߋ Fd`5M D)R@X9Ŋ_ @Lķp'd(R41B&D[У XEWУ*pj/b[:2bQZH@.qKN#x-Ac&\>isM|Srf7=՜S+s%g`4Z1G@@t,D" qj#-F2` U4PJ0`=R7Y-Yh0> `[x2TY(؅=<y 6)3{}73溭orq9v*%B{6R|tXD%Y cL5r"b@FX;"#I S )N SOX(H!]טӆsBI.P@h(TьcuEs!KM-_k+ag\qniNfv̊?*'z H@4 Ȑ)1]p qzi1.I!0 -@ Р` Ҡ {3r ` "%ぷp pb2 ˦ Р 8ΐ{$z6 Ȁ B'2 pG_f`9Z( ^_'ep mzluNP~G@rxNW uVNt(lX_g`)D-7_eq 0e*MH"=1p fx x :(NX00 ( #jvONO0艾H0䈋stH긎8HsVsH0xaD苠hH؀נ^C5׀sXrt ȏ؏ x &ɑ'ጬux2I`瀇a~pVP#5a fp @p 0   =0ғ א1 p~1 mXjt 0n0n&iv}mFvȌO>9Y)W  Vcq p ߵٚ> HI0< zÕ<򛡦7 ЗfL %ٚ9N8y$y i %Q!!֠N @A ! Ӣ HP  Kʤ !R:R H* O ZMz|@b:2: D00 P:Tʣa|`L?z A& J: )\@ ð>#A/{Y3D6@ Mƀ |@|U0;#Z>0t%73U3A)0 i9 B x4 ʪ | ڬͺ z ậ' zӚʭڮ&ʮ:Zzگ + kʰܚіjʭ &J|0|P۱*"[ Kڬ: z* P: K 3 @Z'Ū P : + \ D[:3{|N+k;mYp& w `xz/ฐx;g`WpX/X[pg/˺{븭[{+;ۻ{țʻ gij˸x0pupW0˻hxpiii`i{K+0p;0\|gvg|/PKxp;{v0vp{v0`|u`hf`x`{>XpPCl.W/./ĘTŢ `Oww`w`/` z`d`W`z<VVǀV`VtU0U`UPVF@w\v|ɖLLɕLVʄDŽ\ʃ|ʦʨʪʬʣDz ˴ʶ\˸ʥ0r=c *? <B0,0CAKL<aA0<M(0jylO:=N@:0^.a `N>7p7~:>'긞.^~~N` MU=aQ:'*0>AT0H=b;@'p8郝eD,@)<.c>~**;ܞ`p<a;; "~@!r _q(䋭OOP*PA P+:-+rP$0p<A8YZ(  b``?P@```% !pP荾)0R: [ [JL0_L3^50 *0c p R/=rOrPpPPr@Loȟf&?_o&;  pG*$ s0'n;>TEcj r=BGpjC &4nKCE E#' ,*\a@*C WT!;X2FL>R9ѡ&7n@kW_ņ%;lW92@d(0cN-PzIbpA3,Fs cN&m b fȡUGөQΨ:5Wֱ]FmJ,R@J% G nXo$X"T a2g1At CQ Bo)RQuԆV"X }tMP}Q*ǁz%#;Y 9T4>xW؃O(Wh1C15i:P"zC12T s>l3(40L:$PhZ`(EZ؇L6,D!{MYT%zZ,[3: 00( C3,C4XCK34+ h&30Ёn<HDP HDE:B2;حܚDC.:^찃Y0 xEXEYEZE[Y$"^!  KKT (DDDK ;K8d$K HfZ:@ ( @ 0  a i8pzP4.: ur0,LI!MM,Nԁ$ --' 8PBx'~iz (Q h`ZVR݁ Tb HNMVe]VfmVg}Vh}MVjVkVlVm$H&((p 8 H9(\؁'XЀX 'x`pؓi$ e%deVP]V W8 x'(:HYWP p9L p  " M$dVV'`CL-d6@Z*K]\%.9h89LNmIe @V? II.c f`fa.fb>fcNfd^fc;Cfifjfkkו]8``9]I%Pa('H`9_(X$0X6$p'B?p$p$fEEgNT_60$`؁6_%H/MbnV% ȁ+= K 9a& 0EJނeCliiVނn$6uЀB bWT0iK0iM7(p gjFjx\0d'kNk5k'x'Њg9Xl /h&F@:|t p)VV!2@R BZ !)y1) P|L ^nnn~nnnnn02<~27Ë8<9p{*pZ#<1p0<Ӫ#F 9 8ȃ 0=e!ۃ2Vٯ 1 =1on01 1ۯ!A!0 ((v ;x=:*ؗƸ0x?T7P#*|tP[<5O2|d=㙬Ixݟ>AMM0Q{I@AJ>>IYw}ԟW~W AcO؄?OAxJxM2B%H+T6BA6rƌ7r#HXɓJH$VVmই dV1:|yOQ+IOWJC%Zr &*^8ΘŠIVRȖ `@_$@@ 078r^vWco]sa9s|#@x~`sz|%5wpK^oy쾖t%^x{GS/otmʘ5-߽SN8#@6*=pˆ)t2/P1?R&<S 0?Q}mfx>./eŚBB:RC;àǷ y݁^ F?!P#= Ja̧9,^ȏbf/@6dj`?Qi:E! cXGhx+^1a?lֈ]j&<}Ï!?,91=Ƃ]*,*>xbC nC'4'g_C׳:rAq< G0"HE&P,I騖稇5! a#堌Vu}яٜ 80GqA TdXFSzT0R X7g#ZxM+c厵w{Y`:F9KDxjJ61Z! [bE`^ 䣝zy#^af}%5 >bԭxr5t呅eQ2޵0|g`d<,v2֑=k֢N.}k?<F>1a ''̱I<L]>03f@c~ nu,/}H]DZ5 sfte*}2Ƈ.^ pC7d8"4%0>,@ 3_A@k8@sc: A].0@|re Їxc0ma?ت&ރR>`1}& 9?C-ִ|?V5`W?( $ ȑLFD+Jؚ}1FX=C8/`>C#zF>@Ԭ8Py6l8h2t"\YB# + -<îP];dYCa? 88\ɦ$كÌ]\ .c 6 [ї<MbE1$,e&@-d=셁 *fjY72$tUq،c,\_6& dl\cƀ$HN' L( ΁Q]ۖyKyYi]#_ ^ H)R-c0ԙ]I]0eb%adC(C>57`$7l:|B!`Mf2̂0J=,a6E@3$85u0p,P}:Qej\ RU5dh/X<[& C10*b~=ȼ 7P EX.Ďf"A5 X5Ο0Í@u t@M0L] >øX.^U:_?b.ƒ}ÃPPi^fY:d60R:[3-$Uh&]edڱ]7t6t8td&XZ'#B[{ɆPF5|].0h6](9L 9 har/^P.C邴Z[}=Lǡe?0P1lԴe/LaE[EF{hvkX-ي>`[B_41k&QeC=C54\y 5N/D>4Cڂ& h(Hkqh50l]_˔ktH < >l$5pC780'h*T$D«_ X-TîRCEC3TCN9d<$h>:CzC1tyyոOmT[\.[1C(M>dd0ÃՃȯ5.08R.p?xXCYE֛*cY%PWÿFiG>XCO=4CO\1\8U7.LR.CzhFVY>cC1R/( IC8hw'hL©Z"$,TB% .KFR_;بl֡݃6C>9dzi΀ Im*aJyLFvd0n|'%&pB +qq$w~9CN|wQq|FgQV mtFnDVq)MFf) pmFt8(/B- @.B #,81 xmXy H=`88g6Wi^ OK"[LPV JWWǃp4HɑfO?ȮG?-4pQ|ŠNAg8Y|urh44` +-o (8Gwl# s؃FJ tCm|Mpv܄G 5`H05X(v傆Ok;܃ C."&@B.3B2wPL6jgOg*vgeg0$'㇔<p${GLmG~XD} ȶ(^(!5l@Cw^0 yh^(!#S2<$8l@ =(3.H,-,,*dMB+) 0 Ǫ;;'{O²GO;W_;go;w;;;;; ;׻{@; DI604
Home
Setup Wizard
The Setup Wizard is a useful and easy utility to help setup the DI-604 to quickly connect to your ISP (Internet Service Provider) with only a few steps required. It will guide you step by step to configure the password, time, and WAN settings of your DI-604. The Setup Wizard is a helpful guide for first time users to the DI-604.
 
WAN Settings
WAN (wide area network) Settings are settings that are used to connect to your ISP (Internet Service Provider). The WAN settings are provided to you by your ISP and often times referred to as "public settings". Please select the appropriate option for your specific ISP.
 

WAN - Dynamic IP Address
Select this option if your ISP (Internet Service Provider) provides you an IP address automatically. Cable modem providers typically use dynamic assignment of IP Address.

Host Name - (optional) The Host Name field is optional but may be required by some Internet Service Providers. The default host name is the model number of the device.

MAC Address - (optional) The MAC (Media Access Control) Address field is required by some Internet Service Providers (ISP). The default MAC address is set to the MAC address of the WAN interface in the device. You can use the "Clone MAC Address" button to automatically copy the MAC address of the Ethernet Card installed in the computer used to configure the device. It is only necessary to fill the field if required by your ISP.

 

WAN - Static IP Address
If required by your ISP (Internet Service Provider) select this option to configure the device with the static IP Address information. Enter in the IP address, subnet mask, gateway address, and DNS (domain name server) address(es) provided to you by your ISP. Each IP address entered in the fields must be in the appropriate IP form, which are four IP octets separated by a dot (x.x.x.x). The Router will not accept the IP address if it is not in this format.

Example: 192.168.0.100

 

WAN - PPPoE
Select this option if your ISP requires you to use a PPPoE (Point to Point Protocol over Ethernet) connection. DSL providers typically use this option. Select Dynamic PPPoE to obtain an IP address automatically for your PPPoE connection (used by majority of PPPoE connections). Select Static PPPoE to use a static IP address for your PPPoE connection.

User Name - Enter your PPPoE username.
Password - Enter your PPPoE password.
Service Name - If your ISP uses a service name for the PPPoE connection, enter the service name here. (optional)

Example:@earthlink.net
IP Address - This option is only available for Static PPPoE. Enter in the static IP address for the PPPoE connection.

Primary DNS Address - Primary DNS (Domain Name Server) IP provided by your ISP.
Secondary DNS Address - optional
Maximum Idle time - The amount of time of inactivity before the device will disconnect your PPPoE session. Enter a Maximum Idle Time (in minutes) to define a maximum period of time for which the Internet connection is maintained during inactivity. If the connection is inactive for longer than the defined Maximum Idle Time, then the connection will be dropped. Either set the value for idle time to zero or enable Auto-reconnect to disable this feature.
Auto-reconnect - If enabled, the DI-604 will automatically connect to your ISP after your system is restarted or if the connection is dropped. Auto-reconnect - If enabled, the device will automatically connect to your ISP after your unit is restarted or when the connection is dropped.

 
LAN Settings
These are the IP settings of the LAN (Local Area Network) interface for the device. These settings may be referred to as "private settings". You may change the LAN IP address if needed. The LAN IP address is private to your internal network and cannot be seen on the Internet. The default IP address is 192.168.0.1 with a subnet mask of 255.255.255.0.
IP Address: IP address of the DI-604, default is 192.168.0.1.
Subnet Mask: Subnet Mask of DI-604, default is 255.255.255.0.
Local Domain Name: (optional) Enter in the local domain name for the network.
 
DHCP Server
DHCP stands for Dynamic Host Control Protocol. The DHCP server gives out IP addresses when a device is starting up and request an IP address to be logged on to the network. The device must be set as a DHCP client to "Obtain the IP address automatically". By default, the DHCP Server is enabled in the unit. The DHCP address pool contains the range of the IP address that will automatically be assigned to the clients on the network.
Starting IP address - The starting IP address for the DHCP server's IP assignment.
Ending IP address - The ending IP address for the DHCP server's IP assignment.
Lease Time - The length of time for the IP lease.

DHCP client computers connected to the unit will have their information displayed in the DHCP Client Table. The table will show the Host Name, IP Address, MAC Address, and Expired Time of the DHCP lease for each client computer.

DI604
Tools
System Time
The "system time" setting is used by the unit for synchronizing scheduling services and system logging activities. You will need to set the time zone corresponding to your location. The time can be set manually or the device can connect to a NTP (Network Time Protocol) server to retrieve the time. You may also set Daylight Saving dates and the system time will automatically adjust on those dates.
 
Administrator Settings
There are two accounts that can access the management interface through the web browser. The accounts are admin and user. Admin has read/write access while user has read-only access. User can only view the settings but cannot make any changes. Only the admin account has the ability to change both admin and user account passwords.
 
Remote Management
Remote Management allows the device to be configured through the WAN (Wide Area Network) port from the Internet using a web browser. A username and password is still required to access the browser-based management interface.
IP Address - Internet IP address of the computer that has access to the DI-604. If the IP address is set to *, this allows all Internet IP addresses to access the DI-604.
Port - The port number used to access the DI-604.
Example:
http://x.x.x.x:8080 whereas x.x.x.x is the WAN IP address of the DI-604 and 8080 is the port used for the Web-Management interface.
 
System Settings
The current system settings can be saved as a file onto the local hard drive. The saved file or any other saved setting file created by device can be uploaded into the unit. To reload a system settings file, click on Browse to search the local hard drive for the file to be used. The device can also be reset back to factory default settings by clicking on Restore. Use the restore feature only if necessary. This will erase previously save settings for the unit. Make sure to save your system settings before doing a factory restore.
 
Firmware Upgrade
You can upgrade the firmware of the device using this tool. Make sure that the firmware you want to use is saved on the local hard drive of the computer. Click on Browse to search the local hard drive for the firmware to be used for the update. Upgrading the firmware will not change any of your system settings but it is recommended that you save your system settings before doing a firmware upgrade. Please check the D-Link support site for firmware updates at http://support.dlink.com.
 
Miscellaneous Items
These are additional tools and features of the device.
 
Ping Test
This useful diagnostic utility can be used to check if a computer is on the Internet. It sends ping packets and listens for replies from the specific host. Enter in a host name or the IP address that you want to ping (Packet Internet Groper) and click Ping.
Example:
yahoo.com or 216.115.108.245
 
Restart Device
If for any reason the device is not responding correctly, you may want to restart the unit by clicking on the Restart button.
 
Block WAN Ping
When you "Block WAN Ping", you are causing the public WAN (Wide Area Network) IP address on the device not to respond to ping commands sent by Internet users. Pinging public WAN IP addresses is a common method used by hackers to test whether your WAN IP address is valid.
 
UPnP
UPnP is short for Universal Plug and Play which is a networking architecture that provides compatibility among networking equipment, software, and peripherals. The DI-604 is a UPnP enabled router and will only work with other UPnP devices/softwares. If you do not want to use the UPnP functionality, it can be disabled by selecting "Disabled".
 
Gaming Mode
If you are experiencing difficulties when playing online games or even certain applications that use voice data, you may need to enable Gaming Mode for these applications to work correctly. When not playing games or using these voice applications, it is recommended that Gaming Mode is disabled.
 
VPN Pass-Through
The device supports VPN (Virtual Private Network) pass-through for both PPTP (Point-to-Point Tunneling Protocol) and IPSec (IP Security). Once VPN pass-through is enabled, there is no need to open up virtual services. Multiple VPN connections can be made through the device. This is useful when you have many VPN clients on the local area network.
 
Dynamic DNS
Dynamic DNS (Domain Name Service) is a method of keeping a domain name linked to a changing (dynamic) IP address. With most Cable and DSL connections, you are assigned a dynamic IP address and that address is used only for the duration of that specific connection. With the DI-604, you can setup your DDNS service and the DI-604 will automatically update your DDNS server every time it receives a different IP address.
DI604
Status
Device Information
This page displays the current information for the device. It will display the LAN, WAN, and system firmware information.
If your WAN connection is set up for Dynamic IP address, there will be a Release button and Renew button. Use Release to disconnect from your ISP and use Renew to connect to your ISP.
If your WAN (Wide Area Network) connection is set up for PPPoE, there will be a Connect button and Disconnect button. Use "Disconnect" to drop the PPPoE connection and use "Connect" to establish the PPPoE connection
 
Log
The log file keeps a running log of events and activities occurring on the device. The log will display up to 200 recent logs. Newer log activities will overwrite the older logs. You may want to save the log files by clicking on Log Setting. When the device is rebooted, the logs are automatically cleared.
First Page - The first page of the log.
Last Page - The last page of the log.
Previous - Moves back one log page.
Next - Moves forward one log page.
Clear - Clears the logs completely.
Log Settings - Brings up the page to configure the logs.
 
Log Settings
Not only does the device display the logs of activities and events, it can be setup to send these logs to another location. The logs can be sent via email to a specific email account.
SMTP Server - The address of the SMTP (Simple Mail Transfer Protocol) server that will be used to send the logs.
Email Address - The email address the logs will be sent to. Click on Email Log Now to send the email.
Log Type - Select the type of activities that you want the DI-604 to log.
 
Traffic Statistics
The device keeps statistic of the data traffic that it handles. You are able to view the amount of Receive and Transmit packets that passes through the device on both the WAN (Wide Area Network) port and the LAN (Local Area Network) ports. Click the Refresh button to update the counters and the Reset button to clear the counters. The traffic counter will reset when the device is rebooted.
 
DI-604
     
 
Home
Advanced
Tools
Status
FAQs
 
       
         
         
         
         





























     
JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@4$"!1AqQa"2Bc$RCD!1QaR ?f 1Ip\! =Mt>: 625/r܄fZ6zuKcN+kdtT꺺VQ-NfDnuhx`7!3lQ,[|^OXYw-bA{וujM'Y5lX5=(!vÏ!,CK\:AcIk;j=um[IJYjG|2x&_5&F%G+WZ¶K#/Sro\-g |mk Fg3ͤ2y]7tQR{*֡_S uEkxh,j7Br I1}՝&f |an4QEd@ᑛ<7}Tw?Qn,ύ ;P=!\ eI`g5^3#243|ɉB+.$$:+/ >T( ].~&Wr)E>Cd#b43MV~^l?>2(%Í34&BR,P_[{-M_/[~P6ww?kVkíqojuY~}G/mTQ@g_y'h۷zT>ך.5}cW^j}ouQ@JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@_"!1AQaq2"Bs45b#3CRrSTE&6!1AQaqBR"2b3ᒢ ?$("n/$6R +K7CT[TEFWR_ZgB qy4kqh҈I'(@"RXM3,G VkVgCJND@LI #cz 1JMfѸCER" =iRTOZ"R(JT =iRTJ"R(JT )RTJ"R(OZT )RTJ"RJ/*—8䗩jQ=J>Vm]Km|kCqpcp7jOqoyK4R-lo-_24)E.U)U29bsV:nb?Voe?H*ULYX;odخU*Ö׉*^i㺝^1x/*͗C);+UEa;`kp@$uiWK%A/uZO֩E6pOIKLe四[eyMP:RK댵ݤ"{ !7Ui UC:CB+%L*%%E#]-yn߲ܻ=CSǒɊ6ؽ}ZѰ/* At,Rg>in}1 W Ϧa<;Kx5/dcyF"cGB_%V_+ً+N¹׻0ҼODED@DDD@DDD@zER:{5[8\|7z/Cl]QfRp2]Żhf= h)uQ;G%sp^=F['Ux#F3y$ˣrHN$- [QCqEb WN;[{aI\8ԵDd|gwm~X[]H[`V4x,Z8""PGUeE*]F:RuEԥE (=4ABh@XI-u jm4Jh{vJ" 0t1;Ɵ'ot:L9W4j|9ia']%Ә$,umEjRdJ͹g`Q䵺9 UiE|-h_ f9KrJ+LqM/(=At]RE#9|d.u17$f4.m/|28LOx]A(v*ޮC=y5Ο/y?ࣞ%('+-[Ie Zx.ek |/Vz8RTj铞-+g#-|lM4k𩻻 (Vٶ8s;IU NZЗ݇47 ֋.\Kv==I !'#\.UƩEROLn%'%nZKY5CܼI?RckvQ/a%sy!!̍hH6Hu|2X#8ܔ$'BXYorZw9BrB1ssil@ B.^]+!,`i,R8l=ߋg FsSdӶܤRLg1 >'QKT2%ڒL@!§i||}Z KsWT.d|BgJ 6H!c㸁W*8:[R='%=įHJŬs畠Eq3_ 9\x- y-m4%ҋHt`i(-ݥVyrf_+K##uXQbF%[r漱{cg Tζ\cәyhsHvZzAZת-Gi)4DEDD@DDD@Ep &G,=D9#f䲋&*BWP!qqUo=%%p[*'E M6D :hv.R.<#z[K4U(ep)9j=e&C.NM;F1|B)M;DDD@DDD@u[*o2Eg*V7?FГ;M0Yf9zXxy!kpkR9fe~Es6y[hP1G:q@+fR[NPQV9IA.f{Y;O;v C>E[7=m4 7 kεh""" ""ep 4@Er1W?.Ǭ.aVtU? ~LMmqѹa9x:I h2_ϣ[ޮ1.yzX)ωOOp7.SeZ(۹(D;|iFq${b%-QcoAjU. :'${I#S&[>%>md//̑H^"98a$mxt,T[;qY3Kn7Wms ivkkݍ&kx*pf.DבLXȪv m  'ogm$"y:9쳣grj^8Зd[ %iiwbEDq1ťm׍iP<I)qAZ}-cb%O8ąOSN99a/:)FoX+EFHQh$"UZlBNYj%{F;{+s1xi7৐jxx#"DڪUeRKTym8!?+/w46BNYn-mm? RkƮ&IҝURF9!t=.cۧ˷xҚ/y%ۻo;Eu%pdOC(;&6>oCWJbN1daюUn׾26:Ҁ hVG*~JmjoU4ʊ{]lo+F1MuYʒΙ7RMeRN <=;Ikj粶/b_Nft$zSةutxV.R:-Uд_dgg63BZ1?@Y xX\Z'Dگ" "" 7t%z?#=Wt%z?#=VxCĢ""" ""ʅ+9$Z7d cp[㰿T;ȵ]sFɿCGi]1(}L6)3yO"͐r2sr7BM4 2Xb}+'6~Ños{H)pr# DI+]w-sƔVNdJ7 ֛ة㱺qծwE{>RFvۓNMT'2uvrmҔ٧=2藺q4[x/`P6N.jUkk]}*L5ji.6hr-,tЃzW4B-8+-W&AكٵY@K 47S\8F.54 }:Rg&uS6ȅ # ջ[ya /#ĺ&A Ɖ̞890 Y:XrxO/bDRy-" ""M'7 ^p'7 ^ptS 7J׽j_Ƴ f6?,-.CLM򱣸,D@DDD@DDD@DDD@DDD@DDD@DDD@DDD@DDD@DDD@Gg{Gg{JFIFddDucky(Adobed     $$''$$53335;;;;;;;;;;  %% ## ((%%((22022;;;;;;;;;;"Xqs46 ?؀7:Y%1fiJFIFddDucky(Adobed     $$''$$53335;;;;;;;;;;  %% ## ((%%((22022;;;;;;;;;;"UT! ?=kG DI-604
     
 
DHCP Server
The DI-604 can be setup as a DHCP Server to distribute IP addresses to the LAN network.
DHCP Server Enabled  Disabled
Starting IP Address . . .
Ending IP Address . . .
Lease Time
DHCP Client Table
Host Name IP Address MAC Address Expired Time
 
       
       
       
       
         










     
DI-604
     
 
LAN Settings
The IP address of the DI-604.
IP Address
Subnet Mask
Local Domain Name (optional)
 
       
       
       
       
         
     
DI-604
     
 
WAN Settings
Please select the appropriate option to connect to your ISP.
Dynamic IP Address Choose this option to obtain an IP address automatically from your ISP. (For most Cable modem users)
Static IP Address Choose this option to set static IP information provided to you by your ISP.
PPPoE Choose this option if your ISP uses PPPoE. (For most DSL users)
Others PPTP and BigPond Cable
PPTP
(for Europe use only)
Dynamic IP
Host Name (optional)
MAC Address - - - - - (optional)
 
       
       
       
       
         
     
DI-604
     
 
WAN Settings
Please select the appropriate option to connect to your ISP.
Dynamic IP Address Choose this option to obtain an IP address automatically from your ISP. (For most Cable modem users)
Static IP Address Choose this option to set static IP information provided to you by your ISP.
PPPoE Choose this option if your ISP uses PPPoE. (For most DSL users)
Others PPTP and BigPond Cable
PPTP
(for Europe use only)
Static IP
IP Address (assigned by your ISP)
Subnet Mask
ISP Gateway Address
Primary DNS Address
Secondary DNS Address (optional)
 
 
       
       
       
       
         
     
DI-604
     
 
WAN Settings
Please select the appropriate option to connect to your ISP.
Dynamic IP Address Choose this option to obtain an IP address automatically from your ISP. (For most Cable modem users)
Static IP Address Choose this option to set static IP information provided to you by your ISP.
PPPoE Choose this option if your ISP uses PPPoE. (For most DSL users)
Others PPTP and BigPond Cable
PPTP
(for Europe use only)
PPPoE
  Dynamic PPPoE Static PPPoE
User Name
Password
Retype Password
Service Name (optional)
IP Address
Primary DNS Address
Secondary DNS Address (optional)
Maximum Idle Time Minutes
MTU
Auto-reconnect Enabled Disabled
 
       
       
       
       
         
     
DI-614+
     
 
WAN Settings
Please select the appropriate option to connect to your ISP.
Dynamic IP Address Choose this option to obtain an IP address automatically from your ISP. (For most Cable modem users)
Static IP Address Choose this option to set static IP information provided to you by your ISP.
PPPoE Choose this option if your ISP uses PPPoE. (For most DSL users)
Others PPTP and BigPond Cable
PPTP
(for Europe use only)
IP Address
Subnet Mask
Server IP
PPTP Account
PPTP Password
PPTP Retype password
Maximum Idle Time Minutes
Auto-reconnect Enabled Disabled
 
 
       
       
       
       
         
     
DI-604
     
 
Setup Wizard

The DI-604 is an Ethernet Broadband Router ideal for home networking and small business networking. The setup wizard will guide you to configure the DI-604 to connect to your ISP (Internet Service Provider). The DI-604's easy setup will allow you to have Internet access within minutes. Please follow the setup wizard step by step to configure the DI-604.

 
 
       
       
       
       
         
     
JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@4$"|!1AQ2aq"B3#%1A!a" ?tID^uRꏸ/@ ! bSJM% % %HCo"[R[;t௢S% X\("oF}^Ӫ9 ]*e╱v)IKR'K񊩪m3 *Ke llbI%5TZ)SԵwS]i5 Vo>/ 'ؠ̶XUxs7j w'tHuJf&&gE(yh|-UQ#dEc=1){ SelectRow(tn,i) } } function EnableRow(f, e){ if (e == "1") f.enable[0].checked = true else f.enable[1].checked = true } function ShowWizard(name){ window.open(name,"Wizard","width=450,height=320") } function ExitWizard(){ if (confirm("Quit Setup Wizard and discard settings ?")) window.close() } function ChgPage(i){ var p if (i==0) p="h_wan_dhcp.html" if (i==1) p="h_wan_fix.html" if (i==2) p="h_wan_poe.html" if (i==3) p="h_wan_pptp.html" window.location.href=p } function ChgFilter(i){ var p if (i==0) p="adv_filters.html" if (i==1) p="adv_filters_mac.html" if (i==2) p="adv_filters_url.html" if (i==3) p="adv_filters_domain.html" window.location.href=p } function DelRow(f,r) { EditRow(r) if (confirm("Are your sure you want to delete this entry?")){ f.delrow.value="1" f.submit() } } JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@43" !1AQ"2aqR3Bbc4d!1Aq2 ?kKוRS*hNₜkU3{ I#@l 'EoXͫ\B̚Ϸ,`F x'"kԞЗ0q3v#ߒ*/uwzn]StBHmir+k{rQc"ے(+dmц)JTG^sjSַ4q4v~]ĩvmL8 "pV>yr"jb%*\˾F1e 0uՀ&גb^_A 6MwZʪ\>)X o=%hc'!3%! ;5ʩO'\-Ulp,e boy)TNO55:DsCBzNt^YΏ=}NJTڽLt-Xd.vW~]gOWOSKܹ-JPtT2uQ-H=x|ɯ(:H=x|x|DN9hև̚h[|f h|ɭ:rGZ0YV:Z2tu(C_F/&kbJqk*EG'Yࣧ=_q^q> Ӟ׵|qSӟ*us:(:S>U8SfK7\)l2(zwyܱ!0TD$ 4S IH^ool E?I&NM࣯k%'E)I7ǂtoo I@~M$:ֹRtP"{|x'I&N`$ I<E?I&^too[ IBC:PqwqZCSKHSÊuqwqVBo)AENJpEUzuQϔ^OyEQzu1J)Oqg*ۍKu^rK `_]yʙdbk {Y'qW lF+I`Re!]SuT.ʹ,;pE@uA^\yʴf%QܑGj+4=>7qa%&WfH(K|H]劙ؐ2lDIV͂ˏ9Yuwrᢖl所PVX{./is(ݟHoTh?\Au?Ebbqp[[;!,V04̽}ܶ51v-#8H3mS(HO:{PZX4S>&VSCܥZW_B0*֢ Y2kǒVrwRHVlڴ[Qض#kwk,[{>\:|3]}'gf"_ˣo$'v, %ykˋ]+a}Է\[Se#.4HMW8\O+ޢo9]w)%q=W~ ^.3++el:rSe{Ow $ U I3 (\M+!rחWbߍGc cG4ݻKyd\{ZY svvT6$8<se99c7zM/%qQ~ /dx;[NWo`ܬ3n1%N،yG$pա,a^[:vL0kM&-C׽lՎlÑLRroWZ:-y9&h+8 L@qW zQLz^KlC}F:!#C|Y^bk.;bS$f;qZ p9dlΓ*KG?5˼zk/u^8!卢ݯ{ƴ긮MVcbFA7-܄vQwn`e%XEY #E0zۈcX(( %Rj,QJݫTL^-FRrǛIzi,X- Wsao"Pݎ"WrrbnR% BJi 0E$c8S6To~Iֺ1lAtrk<4;6ϧf\"j؛w<ŹxR a8j?Uk3 ə"!5kNڴ |rHm|Sc4Ü7TmxƨNjj`څ5}P4-t 0 +NY922۔I c р6w%B e,=%GEg)Tl.sW h^:9MBDOsSUVa} ˳c-<̡Ċ+GIKSZ )Q x]83^dקF!.q -9o18\8ܷTo0ihc|{Z> b-s|[<*pX?)+hٝmYKY%"h71ٲڻ6؇>7&jrmw6̸=ֶ T|\KL2˪u$Uq>t1>Cm!"@>aV"e8x*P^t{0Bhb=}!kk "V2MwmWO& KP0=K"̵;q(ܦ}^Ms3bcRKXZGRy]o 7=jK m.%ɋ-2-(fHtCI w|5ig%w6<]VUXqMGA2iu9_5Yr2 s&-,~ [31K$l͑ <+Mţa7ib}} 63aPᒯDX_՚O~n&ccdw+EOܳnSw՝[֓ۼR],OKovz=8՘c.%WlnlY,b`sdkƍٱD i/S1u*v|ri}} xfCx)UWbዲuﻍnZ֛7++ڇ .J9Z[q&=ZD189lqtF UfҚ0w#x  D0@`;zIg2\.I^Ӹ|e M%܇c p?:#73 @],OG+ mG9\$>C$_A>LX ϷۮBbU }3x]3$tw3Ҹ]ONZf/amM#U>&т4q'= =n1'Z } xI kˆ]o ͮ%sG H?Һ{Y1m[xf+x,:c+"P54 Ow3P63f ?N˛ü ɋrc=-[ǿmN๧nFFqTB[yq^.3ۋonS>EpQ|J""""""""(DDE(""DDRJ""(DDE(""/J/""""""""""""""""""^""""""""""""""""/JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@1"| 1!AQqr3s5!1AQq"r3 ?47UuwGz)%:.պYH)}NHGV#9 esޓG\Bj\I`~@iF)ЉoH+(G~zuq|uybBEb9BWj.x|'EJ㖏G;HfY$3t.x̄r>W}C4cox^+T5dZE!>.KLkqi>a*M#&[kH~VZ)>utB wBlBOQN$o|uE0IZK s×H~imKs* dnLWGOǪ [ /4d{Kh˝kD#+d}a mN%9mVd/7yi ,c{,"P xJ'lFMۓ%MWtN&v0 /{aK!AKUoZ6A!n%F?H*L64b ͠F=!24=vu\j ,;H%"z!B"JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@8" c!1AQaqrS4T2#3"sa"RAbSQ2!1 ?V e-/6֎Vu EJ0ߖџoQq ֞m$c<#HIy2$cUoQoQا߀?;Yb <_gg6))ONXy35*ޣ?E8ޣ?EIOM- vɞIW)*M- lSoS LOʾ7N7RlSoPIc䂝gkUN~S}.FwޙˮiKX\m$r0,WgM#-zDEEЊ=GC|cDZVx@)c~M3{.7:0pDpIسq:p+¡1CW ^M P- y;['OfeJ;-T&Vli\Ff6KecuSVIwkM-4m/se.}@-ӻ5ITIy\h"۪Mv{Z(8~Qc${3\Z?yhaK')VuW7kwa/܅KG jP*l/%$MEmxҧ@жN`9cpp}^vQ Qpx%̹͢N$U9$ q bbYlΊ8jj[riM{jwoؙrKJȍfsly6hT(b5Awl_!{kĺjyk:hiVz2l//܅AI֛DSDг0V5Hq:Yn5%7q!w/H](Uƛ ]?Iz8qtOI+ęIDO*6O3SSL$)J\O3SSLDJ\O3SSL$%R |IP59%/R8SL59%/R8W&Ajm-"0Ӳ7\dE """JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@8" QR!1Aqr4a"$2b#!1aRq"b#AQr2B ?V2lh$ j}wW7M%IgfpTVQW0,duۍfpN7M%ITj b;[ql.Idi*QTyt%uۍSfpN7M%ITj b;[ql.Idi*QTyt%uۍfpN7M%IT 2f#Kշ͒ᤥAPʆkr̰ͮ:A]l3lMSX`Wdk3DQW"=w5B޾yJ+]ꩪ0klFNM `9ڑQPe.iz QȀ@iy R=T7_K|WY1+2Kۓ3[V|n='o Ntn,qsj8jwPjcTFudQtH,*<\ (|^5_K|X)REpZm`bUavnZ^[eRyѺ+ӎ |s鋈hJƫoq[J(hFe&fli %6n l %ΈV|j=-U;ֲh]0c@Aİ}<<\ȏ̻ZibO]?fŭr􈊕Ԋ5B޾KZ( fsih6kZ,XTI@dMDvڥ9_RV`2H 1s1Mh-,isi6K;U-l]Tȩč:VbPeDnI=>J^ZpPm2&"A@&ȸxxovUSGIN_l2kzwTD#֞DBlᨊ88l+_FHr"{֨pYODoZ/埈DoZ_ ;ܟ#Ȉ޵ #$wc#$w֣FHr|Dd"#zr0Y{5a6kq:vF ؈ JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@9"!1RTAQa2"r34qb#BC$!"1AabQqc2B4 ?Us!| lʱ/] !Ɯ@;1{_18d"H[jaoWX\Fqo_J.ϘQ_1&l-7(Y9{B/ϘQ_1&l-7'm'9~|Ҏrm#Dܼ؆Gmy{B.ϘQ]1h rۓ,^rJ؆EcmpvY~D`@d ēi4HH‘2F-pnNdܴ@o9[VpU zw zw#셣30f+;}y$Ⱦg`n i Z`94?H޸cWǸ3)4cC fR5Ϧ!%9y&pt 鯘$jCMCX]nFriiH͜C^YQǥNJK%0a&ܪ܂fљ Tko(Io+|^9+TU .,hpN38ձ02zfkcc«+]Dbg[x8ޕGC-dFM3z?0pIHQZfqɀTWWq8Ts D·9l2on"gZ5cK뤨6WiHUSI's|@D%p-:-:M-.z$ 'OV1q 1:t~L  3/O}|{>ࢄ!z+ߊ&ߊ"+8GӜV&K:]x*+}I[[5\kYM%2^L)V> vm]2j((BJFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@8" !1RAQbST2r34aqBCs5 !Q1aqRSA"2b4 ?UQ0Augz*ߊPLEFy\+Vojm a|k(W jyL>7vN7v[wc}Ό>7vN7v[jcTgKz|{Wm{Wmշ%=KʖR1:Gu:Gum? \~-ϸ4׉VojVojINKF_qM-׸k*g4 mpOb3lE"ГE5)qA DZ^_ ¯]>ʴfq,?w(#*Iفy?3 ̊s4Yt 9u\r=#,7K+FkN)4m'ߍָwʝ5kw1_ *2Y)*MSv^wyξZ.a' y%І7o9:u$6UH#e0vW3"ӲeG+r},X;K9$.,{yIa eTN_hqG~Ly ~LyO}{?R"Tz~O+ w'(#*qET"0|XT&W<윯k_ 4\f_8Ҳh]JiJۯl*<d{I ]*\Wi\[J/R Nj2]h*Q \#B$y{bq*S ͳ[ K˿ AW8ҜWiW:jNUrp[njM3p3#U:y~TDl(0E՗ē[JqqTHKTyuW E!G&<~E@(M3fj"L+`^}͓:"VѨ3FdΈ^lӣQygDEtj?6M^lHEɴ͓iѨ6Qm""J>SIį&nB bD@DDJFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@8"R!1SAQq2r4"#ab3!a1AQq"2c4R3S ?2+SM%tQNȑqnEyrX%2 KJ-ña¤3*zſ/'X%m[bz؞;p^bT.^No͎SV;13!T`⼔vY߾7A\0`֚4gW1Z(]깷IqB+I2LGp$I괹4{N 1 $8V5*x>c&595DErdB}$I9g۷໕YmwctRBsj43b ƅ[v=cڳra-1}]};%t|s4."˹Y :4;H&@5Uڜ{]^!UUjaJMwR(j15V2kU_֬ؾ>;[e<&Np&ڍ+j9˗ZL{ NDHyNDHNDHⓈGIQ#)RqD~)8t|"D<7ϫMF<&? DI-604
     
 
Device Information
Firmware Version: ,
LAN
MAC Address 
IP Address 
Subnet Mask 
DHCP Server 
   
WAN
MAC Address 
Connection 
IP Address 
Subnet Mask 
Default Gateway 
DNS 
 
 
       
       
       
       
       














     
DI-604
     
 
View Log

View Log displays the activities occurring on the DI-604. Click on Log Settings for advance features.

Time Message Source Destination Note
 
       
       
       
         
         





























     
DI-604
     
 
Log settings
Logs can be saved by sending it to an admin email address.
SMTP Server / IP Address
Email Address
Log Type
System Activity
  Debug Information
  Attacks
  Dropped Packets
  Notice
 
       
       
       
         
         

 

 

     
DI-604
     
 
Traffic Statistics
Traffic Statistics display Receive and Transmit packets passing through the DI-604.
Receive Transmit
WAN Packets Packets
LAN Packets Packets
 
       
       
       
         
         
     
JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@1" 1!CQ2Bbr4 1Q2Raq#3s ?Ҁ+%dvĘ`#*wboJ )Q'sqޥhCƳ^ G. sykↈ81J4E^=!' z˽ tuκi6Ktx;|s, [z2\O1ǟJFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@1 "!1Qa"RSAq2Bb#3CTr!1QAa"Rq2BS ?|4Ӛ]xeR8G5),RG5&I`HMhɭ2K[V/2jL5i-ub&^dӞ O-D*In*ׅ:s^,$2(|CQX+jC"(&>d,j"(,L5aܷE>dև̙%j tZkCMh|,kS tZSG;J&!9FdZ'7[=$[=-Z}WcP~g:Ix{ZpSE7I/rto&>N Sto'I/rkSe8 )Ix{~g5wC $[=Kſ3ܣZ|QBn^-%ߙMz]F8 )o+Ei+XZFB%U}]>*dPuv;ӫ޴ӞWZpSޝ\]DӞF>EUogs)K)CGڝL}tS^|TȡcN>ҟiQ(L>Շ^B&NҠh D)s ri ;\]N4/ ½"N$r*tPuqv;ӫޣNx:T]E.ߢiϴץȡN>:s)K*dP1SjiO{EQju1NҞ|WvFƥ:9\ey/L215=8~ /a{#i=47xYHG+cO6f1v^rYow$ѸE3X(HU>7qa%&WfH(K|HUjА2kDI-{Z/. 䴌"^,JQw=α+=LeY V  qq'rܸh{~hEZAfMu#\@;JY.\y^ӼŠ! 63?_v-$ß`.\O/+^3Qj/ѷJ7- %yZ2JuA-*[Se#..4ܑ c~)*1vkUpVz_c1I+V ?ҼR?rVç%6WyaVኡ {8zyO7F0nᲙ{1\$x0?v76*^o9YחUŶ;)@Ə4ݼ Kyd\{ZY F5X;#&v q~ۀ]]>I3!|V!ȧP"L9z$":vD(s7ΡMBEϸ mG&YX$@{KIM5fȣ _?[<Oʾ \e[F ?F}"ILC(ĕA!r^QɨU9.M_'X}_{g%ĭ<<~ݔu#yq v ,(v`NhW*ȺX0>ݔ9HڑmٿnI؟s g{yzL>nJE٣W E̊'to{ k6 ``Y *F BY ]&Io >p_>W9{;f2'n˰|H&؃՞ AjbA )ƨQxq߾6fg%O4kqqybn庣yKC<K!:l7vMc-k֩sfQϔ~S;%V5;+ٷXXŐ)ȓEs)]{0Z}-SVnuʢ1gsalˋ1۰1kjGʒS=̲`]FI/s{.jtfKUXHScZq2m/BfKSCjv0+.[5{G,ha0ZvzOSWe1{D0=ݵ]?c6&8oye+$a ;Tq*[zܳ 7sN m*TEuCהM3i$:n!$;> ;ڛif]iU4p&#ك]s^,d\`q^c_]ː5̘T)np?e,96F0󲴭6 /E`74)m58\b _5PO~n&ccdw+߰nܦ*+;(;'J0zܚXfK{zuγ`s^ʒ+76,he 1]95cF` ݱD i/S1u*vxt>>&'ڇ?ow"EŶx:e[(]. su%CkZRvUԪv 赑_] :LIveݷiDu\tS[.\tSTWPN~F2@͹s4o{y56נ:9"o1Wں%( R"\\v<\wYq>;[k|}_+8^[ݱL"DeoH)cmͥV']꣫g໾.-n.Z]`JNmFrZ# t.~)psN*%EЫQyO]lZb⾊WhnڊY~Fre aK[qVXfC{t^>)5㘗{ʧcSrC&"_ܱ2AU{A f(nK{ZC_[ܣvA2.Ⴗg6~x9A$Wb^Eor./ڋ?mG ES伈Y =-Jc=-SG?*5_Gȯ#([[#r=-Z'|0ܢ_vzOZSg~K̚q_WIi @;'ه0!?or;LX:&%䩠ooq+{du94ڬSǓg "Y[SC6UOta& C{gvHqi<%` oH?e.cf H5?eu;kca{-ں4^;7x[ܶٝ+"P54 Om7 ٤AgW7ܒ -YQzZb#V?)Ǩȅyq^.3ۋo=iW>K""e"""""""""""""""""""""""""""""""",DDDDDDDDDDDDDDDDE""""""""""""""""""""DDRJFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@1"| 1!AQaqr3s5 !1AQq"2r ?4=)%vպ9RGu'ƏW:1j\Ih~;vdHKxJ)YDj?OKCy+ ăm=jY(Suߢȭ*rBMvG b<7>tle='tREJFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@1"^s5!QA ??7O?~ _$1F( s[j?oo QJ Oj(51F((JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@9"Q!R1q"2ArS$T#3C !1aAQ"RbSq2r ?^FshvgsAJ\]0J4`84rVK&]frL3tUɺp)ڿ8O(ޛI]0J4`8u_'oMu$.%u]0H^M`Uɺ v7:}frL.$g/&+B洹>$'j7:f&n# vB1ev^ܱ{ ЭͭJRH_EE솧>z[ kg1 xB"Xn]EECy`ຌ߅$H%譮~Hwv̠6g t)N';Iij,+h[zܪN/A5Ԫ><>/fIŷj[do&٢{sF1%$ Zf* I+UVkH,mb̏$qIz]@h̺9/QC5 (]c 3x꘸{.a RkХSI̺0ls͋aHӾBcicc_jý.껜j|~{V%Ԧw*#ڰ^Ն u$MTGa?B Iޛj|~{R%ԓ79QՇz?B~zEEf8lta6b]45`ںD)JE+JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@8" !q2S1abAQ"R$B#3c4!"1ab#AQqR2r ?V 08"`j΢:_5Fk2yyaC̯duIttWFk2sQ̤w^Dw^D|yG+u9mfR];"c ZzaC̳k27:~sH[l82SKV{'DRu .#NVq;{!_]]UKB4 7XW:@I'jHҒMs:;NAܢ[N .2TT"Dz \M𬊇)(Iy9nw _Yÿ&9w7icV:ns`RmSJuKghEw Ng[9r GBLt~?&QPVKr0dkIiGt8=jxJ^g[9rs:;xxe#8Ji1k]3 S>"m,qi8meI؝VYnm^ K>""Sәpb6" :cg>?k|DOV:|ۇo |DF[r"5o([r{s3xtG<-9=oȈռ:|۞Dj>S\Hւh'^җ 4JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@8" !1QAq"2RSTarB34# !1QaA"2b#r႒ ?ҮsO J ~&-È|UI`IR(N8*4ؽl΅ST0{(N8*-Л3{(N8*-Л3oU qu#ʹTnbfɄnd R:M^tXӪ4DiqH}^+ӊE^uh,&H&0t~%~횁H,s[E8A*$.Ne%JA& (]>/5u{e d'Ͷj&%gt @$>H^qs=Fs,V6շjz\ %EWkhw> ~%QrĹKV3TVt.'BƔ%nnUyIwUey0R2s[՝ ΅ $ xm*&h51EDzV?CW-ٽ)iCgFcs<eYОTzEZ=AÆ,o!;oE#toϗJWhTJvHlh pgBzKwz̵G}Q_Sc2 wM#-^ddf?Vt':Jf&S/@u7+EgBBhC)8M&[g2smk~-3xj|.l_fEyѺZMsp AfRMG)9K;wr"k.I:ĝܟImȉtrOv$6GbNnDMӣ|N'y';wr"ou;͹>'Qؓۑ4Im:ĝ܈G%ޏU,VfK ʴ`9 H"(V_JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@8"Q!qѢS1"2TAaBr$b#3c4 !1Q#Aq"2bRr$ ?}:+e)RU,Q]\&T7=Z g`HibRw?oO@sxS 6g`lt,Gs)m}zj;fvb;/ǩOxS&T 3<~=JDj7ڧ@lٝXS&T6=fvO2w>_R7ڧoKIiU>6sH4M [RJN ZeMl7p@ Z;#2$Dv/Fe  9Ő "H"SUD'L]d"tk`)us8މ3PTHᱟ(k횖Ȓe14V,%,Z^V 1Y2aDX@3/9oDH(bzmevet|Cg1;Mu=PI{BTT`,yoDH(rp2χfL2:S2<:i)Ŧ/Ez)mC÷tZvgMH(9oD`әeN}Q WD^-wѠMTWG" z-S6@s*Զ8މ R\aIn2Q5c%೐ɸw/;EJ#u)#>2 q0(@~>jx]O s Ɇo+R_a $j*hj0T6ŕas.2.[:6: Q8tq0kC-{"ŕŕ![7c ty МI=9Gz1XE@nņ6nWLAUɖ_ky(]u>EH+SЎ먔~c)uL_ZvnJUMqe`qe`XW:wݸ3eVf`nRs:6h>i\UQI:@e`qi8LAK["fVX%O"dڪRMv 1ŕJ#*P RGMeoﰾa :g}_ϰoC@e ք8+{f?U3, IWKRY {*W0y~ =GtAV9Nܕc_=+_ےs%X"02tAV9 =*<{rUy~ m'[`rm' u}żL1^}dnT MJFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@<" Q!aђ1q2#STA"Br$R3 !1QAq"b#a2Br ?e\KR`vqNjB_ٛ7'穂w>R`vqNjB_ٛ7'穂w>R`vqNjB_ٛ7'穂w>R`vqNjB_ٛ7'穂w:F)` y S_D6654X, 0+fhj4 j(Vgo~9 Ego~9t,zsi:H:hdB2yO|2M Ԁ8l 6[zGQ;JČJ!*\>Sz('Mrv6qPlآ sv6uRKm9W=)yUoRYhQ;J87Yzd.1N̅drLj$5O Tw7 gPiT5Bz('MrϨkaA+Zl7%` *b40-N'MvVH 'T1.^ﰡh}e/(͵q[̑O"_Dz \u0/*Vv3 Vv9RgQb\:aUعt 0NeÆEgV#b?tLqSEL+w( oL٢(n2|nG,kݙM.TRoĵၻ ܡ w*|t0f&HbWbyrV7eZY7fqd.\E,yʩTbyܬ`'Ҫ4?Э\iUعxA! ^Orw>96C?9opк](hB[Tw/g?,@lʯ!!g/$U k䕣 ~LKm]'O]dvٖ{jFN}UtY۪Ol'19:EUx}d{n<>z#̜duWI̎2m#'H۪Om]'O]dvٓm9:EUx}d{n<>z#̛i]&⪧Ra}Sy1ȥ(oʱgVS:B DI-604
     
 
Administrator Settings
Administrators can change their login password.
Administrator (The Login Name is "admin")
New Password 
Confirm Password 
User (The Login name is "user")
New Password 
Confirm Password 
Remote Management
Enabled Disabled
IP Address 
Port 
 
 
       
       
       
       
       
       
JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@K"Z qs56Ѳ ?׽cg8Cmu%ޱ0H4@7ls 6s#P]qHC5azq0HCH9\R]9ޑs D!zwjk).5ah? DI-604
     
 
Firmware Upgrade
There may be new firmware for your DI-604 to improve functionality and performance.
Click here to check for an upgrade on our support site.
To upgrade the firmware, locate the upgrade file on the local hard drive with the Browse button. Once you have found the file to be used, click the Apply button below to start the firmware upgrade.
Current Firmware Version:
Firmware Date:
 
       
       
       
       
       
       
JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@1" 1!CQ2Bbr4 1Q2Raq#3s ?Ҁ+%dvĘ`#*wboJ )Q'sqޥhCƳ^ G. sykↈ81J4E^=!' z˽ tuκi6Ktx;|s, [z2\O1ǟ DI-604
     
 
Ping Test
Ping Test is used to send "Ping" packets to test if a computer is on the Internet.
Host Name or IP address
Restart Device
Reboots the DI-604.
Block WAN Ping

When you "Block WAN Ping", you are causing the public WAN IP address on the DI-604 to not respond to ping commands. Pinging public WAN IP addresses is a common method used by hackers to test whether your WAN IP address is valid.

Discard PING from WAN side Enabled Disabled
UPNP Settings
Enabled Disabled
Gaming Mode
Enabled Disabled
VPN Pass-Through
Allows VPN connections to work through the DI-604.
PPTP
Enabled Disabled
IPSec
Enabled Disabled
Dynamic DNS
DDNS
Enabled Disabled
Server Address
Host Name
Username
Password
 
 
       
       
       
       
       
     
JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@1 "!1Qa"RSAq2Bb#3CTr!1QAa"Rq2BS ?|4Ӛ]xeR8G5),RG5&I`HMhɭ2K[V/2jL5i-ub&^dӞ O-D*In*ׅ:s^,$2(|CQX+jC"(&>d,j"(,L5aܷE>dև̙%j tZkCMh|,kS tZSG;J&!9FdZ'7[=$[=-Z}WcP~g:Ix{ZpSE7I/rto&>N Sto'I/rkSe8 )Ix{~g5wC $[=Kſ3ܣZ|QBn^-%ߙMz]F8 )o+Ei+XZFB%U}]>*dPuv;ӫ޴ӞWZpSޝ\]DӞF>EUogs)K)CGڝL}tS^|TȡcN>ҟiQ(L>Շ^B&NҠh D)s ri ;\]N4/ ½"N$r*tPuqv;ӫޣNx:T]E.ߢiϴץȡN>:s)K*dP1SjiO{EQju1NҞ|WvFƥ:9\ey/L215=8~ /a{#i=47xYHG+cO6f1v^rYow$ѸE3X(HU>7qa%&WfH(K|HUjА2kDI-{Z/. 䴌"^,JQw=α+=LeY V  qq'rܸh{~hEZAfMu#\@;JY.\y^ӼŠ! 63?_v-$ß`.\O/+^3Qj/ѷJ7- %yZ2JuA-*[Se#..4ܑ c~)*1vkUpVz_c1I+V ?ҼR?rVç%6WyaVኡ {8zyO7F0nᲙ{1\$x0?v76*^o9YחUŶ;)@Ə4ݼ Kyd\{ZY F5X;#&v q~ۀ]]>I3!|V!ȧP"L9z$":vD(s7ΡMBEϸ mG&YX$@{KIM5fȣ _?[<Oʾ \e[F ?F}"ILC(ĕA!r^QɨU9.M_'X}_{g%ĭ<<~ݔu#yq v ,(v`NhW*ȺX0>ݔ9HڑmٿnI؟s g{yzL>nJE٣W E̊'to{ k6 ``Y *F BY ]&Io >p_>W9{;f2'n˰|H&؃՞ AjbA )ƨQxq߾6fg%O4kqqybn庣yKC<K!:l7vMc-k֩sfQϔ~S;%V5;+ٷXXŐ)ȓEs)]{0Z}-SVnuʢ1gsalˋ1۰1kjGʒS=̲`]FI/s{.jtfKUXHScZq2m/BfKSCjv0+.[5{G,ha0ZvzOSWe1{D0=ݵ]?c6&8oye+$a ;Tq*[zܳ 7sN m*TEuCהM3i$:n!$;> ;ڛif]iU4p&#ك]s^,d\`q^c_]ː5̘T)np?e,96F0󲴭6 /E`74)m58\b _5PO~n&ccdw+߰nܦ*+;(;'J0zܚXfK{zuγ`s^ʒ+76,he 1]95cF` ݱD i/S1u*vxt>>&'ڇ?ow"EŶx:e[(]. su%CkZRvUԪv 赑_] :LIveݷiDu\tS[.\tSTWPN~F2@͹s4o{y56נ:9"o1Wں%( R"\\v<\wYq>;[k|}_+8^[ݱL"DeoH)cmͥV']꣫g໾.-n.Z]`JNmFrZ# t.~)psN*%EЫQyO]lZb⾊WhnڊY~Fre aK[qVXfC{t^>)5㘗{ʧcSrC&"_ܱ2AU{A f(nK{ZC_[ܣvA2.Ⴗg6~x9A$Wb^Eor./ڋ?mG ES伈Y =-Jc=-SG?*5_Gȯ#([[#r=-Z'|0ܢ_vzOZSg~K̚q_WIi @;'ه0!?or;LX:&%䩠ooq+{du94ڬSǓg "Y[SC6UOta& C{gvHqi<%` oH?e.cf H5?eu;kca{-ں4^;7x[ܶٝ+"P54 Om7 ٤AgW7ܒ -YQzZb#V?)Ǩȅyq^.3ۋo=iW>K""e"""""""""""""""""""""""""""""""",DDDDDDDDDDDDDDDDE""""""""""""""""""""DDR DI-604
     
 
System Settings
Save Settings To Local Hard Drive



Load Settings From Local Hard Drive




Restore To Factory Default Settings
 
       
       
       
       
       
       
JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@1"| 1!AQaqr3s5 !1AQq"2r ?4=)%vպ9RGu'ƏW:1j\Ih~;vdHKxJ)YDj?OKCy+ ăm=jY(Suߢȭ*rBMvG b<7>tle='tRE DI-604
     
 
Time
Set the DI-604 system time.
Local Time

Time Zone
Default NTP Server (optional)
Set the Time

Year Month Day

Hour Minute Second
Daylight Saving
Enabled Disabled
Start End
 
       
       
       
       
       
     
JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@1"^s5!QA ??7O?~ _$1F( s[j?oo QJ Oj(51F((JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@9" !QR1q3cTAa"C#S !Q"1ARbc$aq2#3sђS ?jQZ^ѧ*e!;b\ p ML#fаiS5אwQy{Z6\YB~jiFEƼŒk;*ř,\YB^S5אwQy{Y76\B?`M(5אwQy{Y36shK-Ҍ#Zy{אwUshX4l4$}ɂ(5T!yie•ai׌cO > G+asEYQ{ `u! JS/SPmy%=8j^$ M3c_j SDrԶKV; O` Uh9+'?R* AKuB"]XU[8PU1yjZ Lx,kkeԦ+]MMT#2r h{V*cNdG;^ߝ.G:]q_k* ܡm[PzL*9.V'>ka-ʣQb4=@'i+vʑjOPk~s.scOTYL-k͜y "0:]%iq9%"d3E&8)O[೸|SO[೸|>a܄! BCWOSG!BIJ:CYش˝y`[}Ɗ)s.uFԤmQKsjcY_?.t^*晠ۅPs7 JȩuU5z".MP,,ȕ~-=dm%Z%ezh^*a@/T 4"rb3ȃJs~SS^*.c\KlI$0b~Ytol226>AFkSce&&ˀB A.sO[೸|2aw<~f~O%G1!]EB [`i6.Bt#m=klk *:nS#zGMEU#zGMEU#:t_Ia^zGMNKzUz'PME),"Z=U>1pC=y(珊)JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@8" QqR!13STA2a"bC% !1AQq"Rb#$da23sB ?5mkhƴiRT S/%ˌN{]'ӞuZSSH+ɹ4,>|u1SꗌN{]'Ӟu]ܛBɹ4#ώ(U/>O=꺹7&7&y>ީxN2}9wU͹4,\ۓB_LQ;7>O=깹&&F=LQ;7>O=긹&H-#BGQު8ˉm?˺!F*5[H% |8xL>FT5#,N"sU=@?ߒ$-*=@i'*҄rR3-bmE` /#9Z/*]2ä 9ZiӋ#" r^}.X/glo+lؐa2/c"EL'🛭MoaP🛭MoOTj>ȈP1O/˩#qBePŭU5#<;ȋM/jq) _3c 5mo:z/Ri ە3oUm|qҚxj׊G->|5jfbJ|sxj yT#oPp00++wfմQFZmv}}h*L3Nv6$J2r(Po]Pʧњ*()/FÈQe}qR 2kNvY,pBAΠ_6:$P8铖@\ֆL|'S[ǘ}]l/֧70.OTj>ȈQPi:;B&] ㍇`>k^҈%wTN)q?=S~{4#nYAo !ֵ޴ř #v-~a/da4n!AUyQ=H3Rl yGN/shn]3]ATK11)q6ԀbkrXW#,DM:J +]ߖܱTeI]Tbqr,Gcܪ#MIA$3I|Ai~qpiBl.~[#r~[#r!jbP0bf]fn+)=;:rOyc[cÞ 0.~[#rodn\{\"ږSx[da-+|BjI()ٍG G}.qp iLBߖܢR ~"t޹󱟲+fUC3y*^o5|}K?1""/Ib!AUyQ~3RȫCL#|/{.֊duV(Rћ^#|8~ ppf`l #؅`8;biP{2{Ռs h`!&F̂ [?W݌v˔DY{l欭2ZqVvwSnT8g3v@Y`[]F_e\K'$ؒi=X8=妩 Wmkե4X^&/DA[6v䳹X2.d2.esݷ4v6 (ZŝVfg%̼YGPlff3vW ;yC3y/w?n~s?ꈈ%*9 cb@Z?+_y\_d/D\=kNW ӕc;wOrqwc9\[b;t'}9\[b;ӕŶ#;wOrqӕŶ#9\[b;t'}9\[b;ӕŶ#;wOrqׅGj[cȵ\#,ֲ"ɔI$|EQGj1־QlJFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@8"!S1QqR3TAa"BC2#!1aQ"bAq2#3%BRsң ?V J }5]1؇ E!%ͩ7Ԝړ}K,Fϑ7#jMs'6w;RGS7s#jMs'6w;RGSA7s#jMs'6w;RISA7:ܧRo9&ڔrH<&A7sur˛Ro9&ږ< %o(#v6w;Rdv }z!p"RN%!Q1v q=ڍ Fmmp ޏWTboZSO1y?S|\Ghu"".i_wo FiGŚVGN c3y(L-cE,4kF u[iJL4u;'5CmoJu(Ԥ*qt1-UDߐqŊ _ƗthUo3z;mmf mغN1JElcڊU0A2HF?#bS,gyaS%,C )sFӈYb몙=lˉ ٷ_]/'+GTS݇ӄIIl`W'~)̺3$m |UOTU=*s~Ko/V|[vR64=LM2#Gf0̢ID6pbB,>-R7F60]$"`~C}Hf̴g[Y> Jcl/1y?S|\Ghu"".at-hI:7!x>YyDZIqD\Tm 84g\Qvq3i.)O餸#ұGIqN"oM%;DޚKqzi.:X M餻MޚKdDzV;iA 9<H:C4";ͥ}URxDZkJFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@<"  S!1aqR#Q3TA"B2C !1"2b#AQa%q3sBRr ?KD@'Xuf5!‘KHIj%-G ".Ԫe:IV\J˭ħ#ڑ|JZjQrKi(%4kiq"G)%-G ".ԢQri(DS|JZjE)j8]E/e4k#-˫RpR/KQK_sIE/Č.KQH%-G .nY}%E/_Gn]ڕ͎k,pnN͍k`d2K4zNin=P+Pu

sSy*:BT!bZNIĶ=PX1"hܹNȹ'ToWA$EtߕrwȎvDzUϴJ*VW'|dG[1>}VW"kʿ;dG;"=*و %lו܊ٯ+;dG;"=*و %lוٯ+;dG;"=*و !44@1& [ȫO[zM4n͵UT"|W(BGIF89aa6*"rav!,?x0eVհi(ð9EP(l d<M#S بk$; DI-604

S
Welcome to the DI-604 Setup Wizard. The Wizard will guide you through these four quick steps. Begin by clicking on Next.
Step 1. Set your new password
Step 2. Choose your time zone
Step 3. Set Internet connection
  Step 4. Restart
 
DI-604
Set Password
 
You may change the admin account password by entering in a new password. Click Next to continue.
Password 
Verify Password 
   

DI-604
Choose Time Zone
 
Select the appropriate time zone for your location and click Next to continue.
   
   
   
DI-604
Select Internet Connection Type (WAN)
Select the connection type to connect to your ISP. Click Next to continue.
Dynamic IP Address Choose this option to obtain an IP address automatically from your ISP.(For most Cable modem users)
Static IP Address Choose this option to set static IP information provided to you by your ISP.
PPPoE Choose this option if your ISP uses PPPoE.(For most DSL users)
PPTP PPTP Client
DI-604
Set PPPoE

 

The service name is optional but may be required by your ISP. Click Next to continue.  
 
User Name
Password
Retype Password
Service Name (optional)
DI-604
Setup Completed
 
The Setup Wizard has completed. Click on Back to modify changes or mistakes. Click Restart to save the current settings and reboot the DI-604.
   
   
   
DI-604
Set Static IP Address
Enter in the static IP information provided to you by your ISP. Click Next to continue.
WAN IP Address
WAN Subnet Mask
WAN Gateway Address
Primary DNS Address
Secondary DNS Address
(optional)
DI-604
Set PPTP Client

 

Please set you PPTP Client data then press Next to continue.  
My IP
Subnet Mask
Server IP
PPTP Account
PPTP Password
Retype Password
DI-604
Set Dynamic IP Address
 
If your ISP require you to enter a specific host name or specific MAC address, please enter it in. The Clone MAC Address button is used to copy the MAC address of your Ethernet adapter to the DI-604. Click Next to continue.
Host Name
(optional)
MAC
- - - - - (optional)

DI-604
S
 
 
JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@""!1AQq2a"r#SBRbC$3T6AQ!BR1qa"r ?^cn;eG:#ΩW;koNh|c-UU+vGÏ:9'K~d`7H5̱ d\ypmg[4>\i2;>\E샀qTwv*v &YrjrXOH$`~6o30F.Šn> ?hZNh<_i2q%N zWVݶ2cRAf7HV&ʼn.C*0%;T{V_gq_vKlx3cm2☳|4!f$B/V^8E[)c%tc |hс$xEh$.o $k8rvՇF8ɿM>N+"]gMso]Ǐ o"Ġq{[ZX&TS܇g.<#kii`3_.n{[+*c+{>\f͡ ʼnne?Bj$qv<+.#Kmk|_=YԫWZeߒ9 :T1B&׽DsF$, ,AyiY_ߢ=^[gOEYa]F;t!YMJC \[MO6M+%ЯmF~ŷAJxseH`@^+7A"m &4NM~<}6y>D|cУo.`'}c{Z꫓S.շ y_2{5'yc(wgL+ +<Oysp6ox/I~in.g_tam?D׳803#I{ keV{EKu,TL=0•ajԛb6Sﭭ/l$*o,J.a[0+^8> (CWE~ƞmq+[!';wO:VyG焺1]&b"Z8 )/P\ocksפ;JylIµW_y/ЬV80>_)݈Ah[iիO=uKS^LԬTtXQSML3#s-wթHP#P8j!IIq&uJ!c ^1o+~.te^Te ƖгТXXzj1&g_ܙs]?jHw39S`לE3Λf1tktxlclkAQYTz^x$mlF=tn}Wo̕з5Rqm.ߓ8uzፁbmE c$3) ^,± HAĥ)z#R)#&:bamاĎF,85N3d[&1^,*n"L̔tL%U".x1 ,k0n~T4NnEOۅL ]/q\`&6{&m,*dB\h ѣs>EpZ>'TG楂] 5W-^^߼/TTvƞIpI4Z38۳1;腥e#Z؎U+r" ^xDž2 1 0 http://:5678 urn:schemas-upnp-org:device:InternetGatewayDevice:1 http://:80 D-Link Router D-Link http://www.dlink.com Internet Access Router D-Link Router uuid:upnp-InternetGatewayDevice-1_0-12345678900001 123456789001 urn:schemas-upnp-org:service:Layer3Forwarding:1 urn:upnp-org:serviceId:L3Forwarding1 /Layer3Forwarding /Layer3Forwarding /Layer3Forwarding.xml urn:schemas-upnp-org:device:WANDevice:1 WANDevice D-Link http://www.dlink.com Internet Access Router D-Link Router 1 http://support.dlink.com 12345678900001 uuid:upnp-WANDevice-1_0-12345678900001 123456789001 urn:schemas-upnp-org:service:WANCommonInterfaceConfig:1 urn:upnp-org:serviceId:WANCommonInterfaceConfig /WANCommonInterfaceConfig /WANCommonInterfaceConfig /WANCommonInterfaceConfig.xml urn:schemas-upnp-org:device:WANConnectionDevice:1 WAN Connection Device D-Link http://www.dlink.com Internet Access Router D-Link Router 1 http://support.dlink.com 12345678900001 uuid:upnp-WANConnectionDevice-1_0-12345678900001 123456789001 urn:schemas-upnp-org:service:WANIPConnection:1 urn:upnp-org:serviceId:WANIPConnection /WANIPConnection /WANIPConnection /WANIPConnection.xml 1 0 SetDefaultConnectionService NewDefaultConnectionService in DefaultConnectionService GetDefaultConnectionService NewDefaultConnectionService out DefaultConnectionService DefaultConnectionService string 1 0 GetCommonLinkProperties NewWANAccessType out WANAccessType NewLayer1UpstreamMaxBitRate out Layer1UpstreamMaxBitRate NewLayer1DownstreamMaxBitRate out Layer1DownstreamMaxBitRate NewPhysicalLinkStatus out PhysicalLinkStatus GetTotalBytesSent NewTotalBytesSent out TotalBytesSent GetTotalBytesReceived NewTotalBytesReceived out TotalBytesReceived GetTotalPacketsSent NewTotalPacketsSent out TotalPacketsSent GetTotalPacketsReceived NewTotalPacketsReceived out TotalPacketsReceived WANAccessType string DSL POTS Cable Ethernet Other Layer1UpstreamMaxBitRate ui4 Layer1DownstreamMaxBitRate ui4 PhysicalLinkStatus string Up Down Initializing Unavailable MaximumActiveConnections ui2 1 2 1 TotalBytesSent ui4 TotalBytesReceived ui4 TotalPacketsSent ui4 TotalPacketsReceived ui4 1 0 SetConnectionType NewConnectionType in ConnectionType GetConnectionTypeInfo NewConnectionType out ConnectionType NewPossibleConnectionTypes out PossibleConnectionTypes ForceTermination RequestConnection GetStatusInfo NewConnectionStatus out ConnectionStatus NewLastConnectionError out LastConnectionError NewUptime out Uptime GetNATRSIPStatus NewRSIPAvailable out RSIPAvailable NewNATEnabled out NATEnabled GetGenericPortMappingEntry NewPortMappingIndex in PortMappingNumberOfEntries NewRemoteHost out RemoteHost NewExternalPort out ExternalPort NewProtocol out PortMappingProtocol NewInternalPort out InternalPort NewInternalClient out InternalClient NewEnabled out PortMappingEnabled NewPortMappingDescription out PortMappingDescription NewLeaseDuration out PortMappingLeaseDuration GetSpecificPortMappingEntry NewRemoteHost in RemoteHost NewExternalPort in ExternalPort NewProtocol in PortMappingProtocol NewInternalPort out InternalPort NewInternalClient out InternalClient NewEnabled out PortMappingEnabled NewPortMappingDescription out PortMappingDescription NewLeaseDuration out PortMappingLeaseDuration AddPortMapping NewRemoteHost in RemoteHost NewExternalPort in ExternalPort NewProtocol in PortMappingProtocol NewInternalPort in InternalPort NewInternalClient in InternalClient NewEnabled in PortMappingEnabled NewPortMappingDescription in PortMappingDescription NewLeaseDuration in PortMappingLeaseDuration DeletePortMapping NewRemoteHost in RemoteHost NewExternalPort in ExternalPort NewProtocol in PortMappingProtocol GetExternalIPAddress NewExternalIPAddress out ExternalIPAddress ConnectionType string PossibleConnectionTypes string Unconfigured IP_Routed IP_Bridged ConnectionStatus string Unconfigured Unconfigured Connected Disconnected Uptime ui4 LastConnectionError string ERROR_NONE ERROR_UNKNOWN RSIPAvailable boolean NATEnabled boolean ExternalIPAddress string PortMappingNumberOfEntries ui2 PortMappingEnabled boolean PortMappingLeaseDuration ui4 RemoteHost string ExternalPort ui2 InternalPort ui2 PortMappingProtocol string TCP UDP InternalClient string PortMappingDescription string h_wizard.htmlh_wan.htmlapply_p.jpgadvhtml_04.jpgadvhtml_05.jpgadvhtml_06.jpgadvhtml_07.jpgadvhtml_12.jpgadvhtml_17.jpgadvhtml_22.jpgadvhtml_27.jpgadvhtml_32.jpgadv_appl.htmladv_dmz.htmladv_dmz.jpgadv_dmz_over.jpgadv_filters.htmladv_firewall.htmladv_filters_url.htmladv_filters_domain.htmladv_filters_mac.htmladv_over_12.jpgadv_over_17.jpgadv_over_22.jpgadv_over_27.jpgadv_over_32.jpgadv_virtual.htmlback.htmback_p.jpgcancel_p.jpgclose.htmcontinue_p.gifdelet.gifdown.gifdown_01.gifdown_02.jpgdown_03.jpgdown_04.jpgdown_05.jpgdown_06.jpgdown_09.gifdown_10.jpgdown_11.gifdown_12.jpgdown_13.jpgdown_14.gifdown_17.jpgdown_18.gifdown_19.gifdown_22.jpgdown_27.jpgdown_37.gifdown_39.gifdown_40.gifdown_43.jpgdown_43.gifdown_44.gifdown_over_12.jpgdown_over_17.jpgdown_over_22.jpgdown_over_27.jpgedit.gifexit_p.jpghelp_04.jpghelp_05.jpghelp_06.jpghelp_07.jpghelp_over_12.jpghelp_faq.htmlhelp_adv.htmlhelp_adv_p1.gifhelp_home.htmlhelp_tools.htmlhelp_status.htmlhelp_men.htmlhelp_p.jpghome_01.jpghome_02.jpghome_03.jpgh_dhcp.htmlh_lan.htmlh_wan_dhcp.htmlh_wan_fix.htmlh_wan_poe.htmlh_wan_pptp.htmlnext_p.jpgpublic.jsreload.htmrestart_p.jpgstatus_04.jpgstatus_05.jpgstatus_06.jpgstatus_07.jpgstatus_12.jpgstatus_17.jpgstatus_22.jpgstatus_over_12.jpgstatus_over_17.jpgstatus_over_22.jpgst_devic.htmlst_log.htmlst_log_settings.htmlst_stats.htmltools_04.jpgtools_05.jpgtools_06.jpgtools_07.jpgtools_12.jpgtools_17.jpgtools_22.jpgtools_27.jpgtools_32.jpgtools_admin.htmltools_over_03.jpgtools_firmw.htmltools_over_04.jpgtools_misc.htmltools_over_05.jpgtools_system.htmltools_over_06.jpgtools_time.htmltools_over_07.jpgtools_over_12.jpgtools_over_17.jpgtools_over_22.jpgtools_over_27.jpgtools_over_32.jpgup.gifwizard.htmwizard1.htmwizard2.htmwizard4.htmwizard6.htmwizard8.htmwizard5.htmwizard9.htmwizard10.htmwizard_m.htmww.jpgigd.xmllayer3forwarding.xmlwancommoninterfaceconfig.xmlwanipconnection.xmlsa.cgidmz.cgiipf.cgirule.cgiurl.cgidomain.cgimac.cgivs.cgih_dhcp.cgih_lan.cgih_wan_dhcp.cgih_wan_fix.cgih_wan_poe.cgih_wan_pptp.cgistatus.cgilog.cgilog_set.cgistats.cgitools_admin.cgiupgrade.cgiping.cgirestart.cgitools_misc.cgiload.cgirestore.cgitools_time.cgiwizard1.cgiwizard2.cgiwizard4.cgiwizard6.cgiwizard8.cgiwizard5.cgiwizard9.cgiwizard10.cgiJreleasesendnowconnectadddelsetrenewapplyclearcloneupdateaddPerdelPeraddBlkdelBlkMonth,is wrong.pptpconnectConnectedDisconnectingDay,is wrong.generateprioritydisconnectpptpdisconnectDisconnectedConnectingYear,is wrong.Hour,is wrong.Minute,is wrong.Second,is wrong.javascript:window.history.back();back.htmjavascript:window.history.back();wizard_m.htmrebootThe device is restarting...rebootThe device is restarting...rebootclose.htmSettings Savededitdeletepriority updownreload.htmOnly admin account can change the settings.WANIPConnectionEthernet10000000UpIP_RoutedConnectedERROR_NONE%u.%u.%u.%u010%sTCP%dInvalid WAN Subnet Maskwizard8.htmInvalid WAN IP AddressPPTP Password mismatchPPPoE Password mismatchwizard8.htmPPPoE User Name field is emptywizard5.htmwizard6.htmwizard9.htmwizard10.htmInvalid WAN Subnet MaskInvalid WAN Gateway AddressInvalid DNS Addresswizard8.htmInvalid WAN IP AddressSettings Savedwizard2.htmPassword mismatchwizard4.htm%dselectedh_wan_dhcp.htmlInvalid MAC Address.Invalid WAN Subnet MaskInvalid WAN Gateway AddressInvalid DNS AddressInvalid WAN IP Addressh_wan_fix.htmlPPPoE Password mismatchIP Address is emptyInvalid MTU size (%d-%d).Invalid WAN IP AddressInvalid Primary DNS Address.Invalid Secondary DNS Address.h_wan_poe.htmlInvalid WAN Subnet Maskh_wan_pptp.htmlPassword mismatchInvalid WAN IP Addresswizard8.htmwizard10.htmInvalid MAC Address.Invalid LAN Subnet MaskInvalid LAN IP Addressh_lan.html%uReserved%s%u.%u.%u.%u%02x-%02x-%02x-%02x-%02x-%02x%sInvalid Starting IP Addressh_dhcp.htmlInvalid Ending IP AddressEnding IP must be larger than Starting IP%02x%02x-%02x-%02x-%02x-%02x-%02x%s
No space to add this entry.Port range conflit with "%s".User password mismatch.Invalid HTTP Remote IP.Invalid HTTP port number.Administrator password mismatch.ping completespecify valid IP hostPing Result : SuccessfulPing Result : Time outPing Result : Unknown hostping %sInvalid IP addressPing Result : Not executed1Host Name field is empty.Server field is empty.Username field is empty.Password field is empty.You are setting PPTP Client, please set PPTP pass through disable%dSystem time is %s.*%u.%u.%u.%u%u.%u.%u.%u*%u%uPPPoEPPTP%u.%u.%u.%u%u.%u.%u.%u fixed IPDHCP Client %s  %s Fixed IP %s  %s %s  %s %s  %dpage %d of %d%u%uInvalid Trap Receiver addressadv_snmp.htmlManualtype%dSubject: Manualst_log.htmlSMTP Server or Email Address is empty.Sending one E-mailE-mail has been sentThe chosen file is not a firmware file.No file has been chosen.tools_firmw.htmlThe version of setting file is not compatible.tools_misc.htmlreceive configuration file tools_system.htmlNo file has been chosen.CFG checksum errorThe chosen file is not a system settings file.tools_system.htmlIPSec_ESPPPTP_GREAMPMalways%02d:%02d %s-%02d:%02d %s,%s-%sInvalid IP Address.The entry has been deleted.Invalid Schedule day range.No space to add this entry.Invalid Private IP of LAN Server.Name field is empty.Invalid Schedule time range.rDat[%d] = "%d,%s,%u.%u.%u.%u,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d" checked%s%u.%u.%u.%u%s %d/%d%s%s%s -%d" ,%d%d%srDat[%d] = "%d,%s,%d,%s,%d,%d" pPort[%d] = "-%d,%d%s checked %s%d%sThe entry has been deleted.Invalid port range.No space to add this entry.Name field is empty.%d,%d,%d*,%u.%u.%u.%u,%u.%u.%u.%urDat[%d] = "%d,%s,%d,%s,%d,%d,%d,%d,%d,%d,%d,%d,%d" %u.%u.%u.%u, checked %s%s %s%s%s%s The entry has been deleted.Invalid port range.Invalid Schedule day range.No space to add this entry.Invalid IP range.Invalid Schedule time range.
%02x%c%02x%c%02x%c%02x%c%02x%c%02xrDat[%d] = "%s,%s" dDat[%d] = "%s,%s" %s%s%s%s MAC Filter is disabled, because MAC table is empty.
The entry has been deleted.No space to add this entry.The MAC Address is the same as user "%s".Invalid MAC Address.Name field is empty.MAC table is empty, so the "only allow mode" can't be set.LANWAN*%d,%d,%d*,%u.%u.%u.%u,%u.%u.%u.%u%u.%u.%u.%u,rDat[%d] = "%d,%c,%d,%s,%d,%d,%s,%d,%s,%d,%s,%d,%d,%d,%d,%d,%d,%d,%d,%d" AllowDeny checked%s%s%s,%s%s,%s%s,%s%s%s%s%s The entry has been deleted.Invalid port range.Invalid Schedule day range.No space to add this entry.Invalid Destination IP range.Can not delete this rule here.Name field is empty.Invalid Source IP range.Invalid Schedule time range.%dNo space to add this entry.Nothing to delete.No space to add this entry.Nothing to delete.The line is connecting.Renew IP successfulTry to establish PPPoE lineRelease IP successfulManual DialupManual HangupDisconnect PPPoE lineRelease IP timeoutRenew IP timeoutThe line is connected or connecting.The line is disconnecting.The line is disconnected or disconnecting.Disconnect PPTP lineNo space to add this entry.Invalid IP Address.%u.%u.%u.%u%02x %c%u.%u.%u.%u%d minutes, %d sec.%ld days, %dh:%dm:%ds%d hours, %dm:%dspanic: %s ns_printf:Buffer overflow%s ....press any key for more (ESC to break)....each number must be less than 255all chars must be digits (0-9) or dots (.)string must contain 3 dots (.)no digit between dotError sending DHCP packet on iface %d. Error starting DHCP client code. DHCP client: got address %s boundunusedinitinit-rebootrebootingselectingrebindingrequestingrenewingrestartingDHCP Request successMSFT 98DHCP DiscoverMSFT 98routerDHCP RequestDHCP Releasedhcp client stats: all errors: %lu discover sent: %lu offers rcvd: %lu requests sent: %lu acks received: %lu bootp replys: %lu declines sent: %lu releases sent: %lu naks received: %lu renew req sent: %lu rebind req sent: %lu lease=%lu, t1=%lu, t2=%lu DNS%d=%u.%u.%u.%u Interface %d state = %s tries=%d, xid=%lu, secs=%d ip=%u.%u.%u.%u, snmask=%u.%u.%u.%u, gw=%u.%u.%u.%u serverip=%u.%u.%u.%u DHCP Rebind no responseDHCP Discover no responseDHCP Request no response]g Unknown command: %s Hey Moe, it dont woik. NYUK NYUK NYUK NYUK *bop* Owww! %s %-29s - %s %-12s(%15s) - %s %s generaldefaultlanmaskdhcpsrvipstartwanmaskpoenamepoepasschannelfooEGPGGPRIPstatesetuplanipipendwanipwangwpoeipessidOTHERLOCALHELLOpasswdexitbackmainlansrvsavewansrvdnsip1dnsip2dnsip3poesrvwlasrvOOPS> NETMGTICMPGo to Main pageset system password1:DHCP client 2:Fixed IP 3:PPPoE Automatic 4:PPPoE Fixed IPmain menuBack to previous pageSetup LAN IP masksave configuration and rebootSetup WAN IP maskwlaenableEnable(1) or disable(0) wireless functionshow current station setuprestore factory default and rebootlogout console mode without savesetupsrvmain setuplansetupLAN settingswansetupWAN settingsSetup LAN IP addressEnable(1) or disable(0) DHCP server functionDHCP pool : start IP addressDHCP pool : end IP addressconntypefixipsrvSetup WAN IP addressSetup WAN IP gatewaySetup DNS IP 1Setup DNS IP 2Setup DNS IP 3PPPoE account namePPPoE account passwordPPPoE fixed IP addressset WLAN essidset WLAN channel no.***************%u%u.%u.%u.%u%ddisenPacket hex dumping %sabled offonsnmp agent turned %s community strings are limited to %d characters Set default community string to "%s" Community is "%s"; to change it please specify new one. bigfreeq: head:%p, tail:%p, len:%d, min:%d, max:%d lilfreeq: head:%p, tail:%p, len:%d, min:%d, max:%d rcvdq: head:%p, tail:%p, len:%d, min:%d, max:%d Not debug build lilbigrcvnon%s enter memory location in hex, followed by optional length. %u.%u.%u.%u %u.%u.%u.%u %u.%u.%u.%u %d %s no IP routes set ..IPaddr.......mask.........nexthop...iface..type usage: target.ip target.mask next.hop iface where 1st 3 parms are in IP dot notation, last is digit 1-%d bad IP format "%s" in arg %d, problem: %s add_route failed, table full? %u.%u.%u.%u1: enable, 0: disable number from 1 to 253 1:DHCP client 2:Fixed IP 3:PPPoE Automatic 4:PPPoE Fixed IP 1: enable, 0: disable NULLh_name is %s %d.%d.%d.%d usage: nslookup host_name gethostbyname() returned NULL gethostbyname() succeeded h_addrtype = %d h_length = %d h_addr_list are no addresses DNS server number must be 1-%d usage: setdnssvr X.X.X.X [Server No. (1-%d)] IP address error: %s no interface named "%s". interface number must be 1 to %d. %u.%u.%u.%u>MTCPUDPGREESPBADICMPport number conflict:%u Found a SYN Flood curr time : %u <-> %u.%u.%u.%u:%u, out_port:%u, last_use:%u %d) %s %u.%u.%u.%u:%u UISAKMP Discard packetNo bufferzero SPI from %d.%d.%d.%d discardedNo bufferOut of NAT buffer (2)Discard packetIPSEC Discard packetDrop packet from LANzero SPI from %d.%d.%d.%d discardedOut of NAT buffer (3)Discard packetIPSEC Discard packetNo buffer1Drop packet from LAN>PPPoE: opening connection ...PPTP Cli: opening connection ...I#no app_data - what now? couldn't add GRE nat entry. This is a strange problem. Allocate packet buffer failAuto reset TCP 113 sessionSYN Flood Attack DetectPacket DroppedDrop %s packet from WANDisable PPTP Pass ThroughRule: %s denyOut of NAT bufferNo any rule can applydo_nat: buffer (%d) too small Disable IPSEC Pass ThroughDrop packet from WANDrop %s packet from WANDisable PPTP Pass ThroughDrop %s packet from LANDisable PPTP Pass ThroughOut of NAT buffer (1)Rule: %s denyNo any rule can applyDisable IPSEC Pass ThroughDrop packet from LANqkPORTPASV%u,%u,%u,%u,%u,%uxERRORAssigned via DHCPUnassignedAssigned via BOOTPDHCP Offerbootptabdynamic sniffed dbase receive an unknown DHCP type(%u)Bad DNSBad Subnet maskIP address in useDHCP lease IP %u.%u.%u.%u to %15s%02x-%02x-%02x-%02x-%02x-%02xIP address out of poolIP address not yoursdiscover packets received: %lu declines received: %lu releases received: %lu acks sent: %lu naks sent: %lu plain bootp requests received: %lu dhcp request packets received: %lu plain bootp replys sent: %lu offer packets sent: %lu requests for other servers: %lu protocol errors; all types: %lu IP addr client ID type status lease no DHCP/BOOTP entrys in database %2d %u.%u.%u.%u %s %s %s %ld %u Entries subnet:%u.%u.%u.%u gateway:%u.%u.%u.%u DNS:%u.%u.%u.%u IP:%u.%u.%u.%u - client ID:%s - status:%s lease %ld, type: %s, name: %s DHCP ServerNo free IP addressunknownDHCP ServerNo free IP addressDHCP server: %s at line %d of file %s 0bad iface numberproblem (%s) parsing IP address "%s", trying 0.0.0.0 WARNING: DHCP server default subnet mask is 0.0.0.0 on iface %dlease should be positive seconds count or -1bad address pool indexpool high addressmissing pool indexmissing pool indexpool low addressbad iface numberClient ID not hex valuelease should be positive seconds count or -1 dhcprecs.nvdhcpsrv.nvdh_getfreeaddrs: calledAuthReqAuthAckAuthNakNo response to PAP authenticate-requestsPAP authentication of peer failed (protocol-reject)PAP authentication failed due to protocol-rejectupap_input: rcvd short header.upap_input: rcvd illegal length.upap_input: rcvd short packet.upap_rauth: Rcvd id %d.upap_rauth: rcvd short packet.upap_rauthack: rcvd short packet.upap_rauthack: Rcvd id %d.Remote message: %supap_rauthnak: rcvd short packet.PAP authentication failedupap_rauthnak: Rcvd id %d.Remote message: %supap_sauth: Sent id %d.upap_sresp: Sent code %d, id %d. %s %.2xmsg=%s code=0x%x id=0x%x user=%s password=%s$INITIALSTOPPEDCLOSINGREQSENTACKRCVDACKSENTCONFREQCONFACKCONFNAKCONFREJTERMREQTERMACKCODEREJPROTREJDISCREQFOOCLOSEDOPENEDKEEPALIVESTARTINGSTOPPINGPECHOREQPECHOREPfsm_init(%s): state %s FSMCHECK fsm_lowerup(%s): unit: %d, state %s fsm_lowerup(%s): unit: %d, up event in state %d!%s: Down event in state %d!FSMCHECK fsm_lowerdown(%s): unit: %d, state %s fsm_open(%s): unit: %d, state %s FSMCHECK fsm_open: bad fsm fsm_close: bad fsm FSMCHECK fsm_close(%s): unit: %d, state %s %s: timeout sending Config-RequestsFSMCHECK fsm_timeout(%s): bad state %sfsm_timeout(%s): unit: %d, state %s fsm_input(%x): Rcvd packet in state %s.fsm_input(%x): Rcvd illegal length.FSMCHECK fsm_input(%x): Rcvd short header.fsm_input(%x): Rcvd short packet.fsm_input(%s); code %s, state %s, len %d, id %u fsm_rconfreq(%s): Rcvd id %d.FSMCHECK FSMCHECK fsm: %s: received bad Ack (length %d)fsm_rconfack(%s): state %s Rcvd id %d.fsm_rconfack: bad id, expected %d NakrejectFSMCHECK fsm_rconfnakrej(%s): Rcvd id %d.fsm_rconfnakrej: Bad id %d, expected %s.fsm:(%s) received bad %s (length %d)%s terminated at peer's requestfsm_rtermreq(%s): Rcvd id %d.FSMCHECK fsm_rtermack(%s).FSMCHECK %s: Rcvd Code-Reject for code %d, id %dfsm_rcoderej(%s).FSMCHECK fsm_rcoderej: Rcvd short Code-Reject packet!%s: Protocol-reject event in state %d!%s: sent Configure-Request, id %dfsm_sdata(%s): unit %d truncated code %s, state %s, id %d! fsm_sdata(%s): unit %d sent code %s, state %s, id %d tpppwrite: queue full pppwrite: oversize length pppwrite: retry dropped ppprawwrite: oversize length ppprawwrite: fast Q full ppprawwrite: can't alloc pkt pppstart: ok pppstart; unit %d:pppstart: Error writing byte no. %d to Comm device. fcs not ok ?? pppinit: alloc failed got a PAP packet ppp_infrm: Unsupported PPP type 0x%x ppp_infrm: unit %d Got a Packet Got IP packet, len %d lcp packet =ipcp packet = got a CHAP packet pppinput: got PPP_FLAG ppp%d: missing ALLSTATIONS, got 0x%x; flags %x ppp: bad fcs, unit=%d ppp_input: flushed, unit=%d, flushed=%d pppinput: unit: %d short pkt (%d) ppp%d: missing UI, got 0x%x ppp_input: bad protocol %x, inbuf:ppp_input: packet too big %s %d.%d.%d.%dIPCPipcp_addci: ouraddr==0.0.0.0 ipcp_ackci: ouraddr==0.0.0.0 ipcp_ackci: received bad Ack!local IP address %sipcp_nakci: received bad Nak!remote IP address %slocal primary DNS address %slocal secondary DNS address %sipcp_rejci: ouraddr==0.0.0.0 ipcp_rejci: received bad Reject!%s)ACKNAKREJ(%s:(%s)(%d) (%s) ipcp: received DNSADDR_PRI ipcp: received DNSADDR_SEC ipcp: received ADDRS ipcp_reqci: ouraddr==0.0.0.0 ipcp_reqci: bad CI length!ipcp: received ADDR ipcp: received COMPRESSTYPE ipcp: returning Configure-%sPeer is not authorized to use remote address %sCould not determine remote IP addressipcp: upCould not determine local IP addressIPCP: local IP address %sIPCP: remote IP address %ssifaddr failedsifup failedipcp: down+LCPlcp_init lcp: Echo-Request, Rcvd id %dlcp_rprotrej.lcp_rprotrej: Rcvd Protocol-Reject packet for %x!lcp_rprotrej: Rcvd short Protocol-Reject packet!Protocol-Reject discarded: LCP in state %dlcp_protrej: Received Protocol-Reject for LCP!Bug in lcp_addci: wrong lengthlcp_acki: received bad Ack!The line appears to be looped back.lcp_nakci: received bad Nak!lcp_rejci rejected short opt %dlcp_rejci: received bad Reject!lcp_rejci MD5 rejected - don't try CHAP next time. lcp_rejci rejected LQR opt %dlcp_rejci rejected long opt %dlcp_rejci rejected void opt %dlcp_rejci: plen %d len %d off %dACKNAKREJ(%lx) (%s)(%d)(%x)lcp_reqci: rcvd QUALITYlcp_reqci: rcvd MRUlcp_reqci: rcvd MAGICNUMBERlcp_reqci: bad CI length!lcp_reqci: rcvd ACCOMPRESSIONlcp_reqci: rcvd unknown option %dlcp_reqci: rcvd ASYNCMAPlcp_reqci: rcvd AUTHTYPE(%x %lx)lcp_reqci: rcvd PCOMPRESSIONlcp_reqci: returning CONF%s.LCP is down.y"dogbert%s@%sPAP setup: required: %d, username: %s, password: %s ppp_logfile: not supported on this build. OFFONppp file logging turned %s PAP access failed, bad user or passwordPAP access OKpelinksSESSIONBADpppoepemapINITCLOSEDList PPPoE sessionspesessionpppoe menuList PPPoE linksmap PPPoE interface to ether interfacePADISENTPADRSENTPPPoE: no iface for unit %d PPPoE: iface for unit %d not ethernet Server timeout!Disconnect PPPoE linePPPoE Idle Timeout !PPPoE Retry FailPPPoEno memoryno available PPP sessionPPPoE: establish_ppp error %d runtbad servicenamePPPoE: Receive PADT TAGbad vers/typepoe_rcvctrl: error tag 0x%x; data:%s Disconnect PPPoE lineshort ctrl_lenunacceptable tag valuepoe_rxctlcode code 0x%x no AC namebad codeno sessionPPPoE: Receive Error TAGPPPoE rcv err %s; pkt type 0x%x PPPoE: prepend et_send: prependpoe_disconnect: already closed poe_disconnect on unit %d poe_disconnect: no line (NULL)no current PPPoE sessions. Service:"%s" AC:"%s" state: %s, retrys:%d, Id:%d, iface:"%s" pkts; in: %lu, out:%lu, last-ctrl:%lu last-rxdata:%lu mapped to ether iface %s, IP %u.%u.%u.%u iface %s is PPPoE (unit %d), IP %u.%u.%u.%u, mask %u.%u.%u.%u pestablish_ppp: line failed ppp: link_terminated: iface %d link_required: ln_connect() failed PPP linkppp_quit: iface %d not up. ppp_quit: iface %d, unit %d ppprawwrite: error %d ppp_pkt_output: no MAC prepend spacesifdefaultroute: unit:%d, IP:%x cifdefaultroute: unit:d, IP:%x sifproxyarp: unit:%d, IP:%x cifproxyarp: unit:%d, IP:%x demuxprotrej: Unrecognized Protocol-Reject for protocol %d!timeout: got time of %d SILENT MRU:%d P-compoff UPAP CHAP LQRonppptimers: created:%lu, deleted:%lu, fired:%lu packets: In: %10lu Out: %10lu bytes : In: %10lu Out: %10lu MAG.NUMBER errors : In: %10u Out: %10u logging: file %s, console %s PPP unit: %d, iface: %d, mtu:%u mru:%u timer:%u FSM states; LCP:%s, IPCP:%s LCP options: PASSIVE RESTART ASYNCMAP:%d AC-comp q: count(sec) %u, arg: %lx, func:%p fastq: head:%p, tail:%p, len:%d, min:%d, max:%d IPque: head:%p, tail:%p, len:%d, min:%d, max:%d ppp: ip_input: can't get buffer, length %d Peer failed authentication, unit %d, type 0x%x AUTH FAILURE: Peer failed authentication. Auth FAILURE: We failed authentication with peer, unit %d. Auth FAILURE: We failed authentication with peer on %d, type 0x%x. peer authenticated with us OK on %d, type %d We authenticated with peer OK on %d, type %d ppp_check() LCP_FSM closed ppp_check() - timeout while waiting for PPP to close ppp_check() - LCP, IPCP are in OPENED state . ppp_check() - connect failed, cleaning up INITIALPENDINGBADAUTHCLOSEDLISTENOPENRECHALLENGERESPONSEINITIAL_CHALChapAuthWithPeer: unit:%d, our_name:%s, digest(type):%dPeer failed to respond to CHAP challengeChapInput: rcvd illegal length.ChapInput: rcvd short header.ChapInput: rcvd short packet.Unknown CHAP code (%d) received.ChapReceiveChallenge: in state %dChapReceiveChallenge: received name field: %sChapReceiveChallenge: unit: %d Rcvd id %d.ChapReceiveChallenge: rcvd short packet.No CHAP secret found for authenticating us to %sMD5ing; id:%d, secret:%s, chal_len:%u unknown digest type %dChapReceiveResponse: rcvd short packet.CHAP peer authentication failedChapReceiveResponse: unit: %d Rcvd id %d.ChapReceiveResponse: in state %dChapReceiveResponse: received name field: %sNo CHAP secret found for authenticating %sMD5ing; id:%d, secret:%s, chal_len:%u unknown digest type %dChapReceiveSuccess: unit:%d Rcvd id %d.ChapReceiveSuccess: in state %d Remote message: %sChapReceiveFailure: unit: %d, Rcvd id %d.ChapReceiveFailure: in state %d Remote message: %sCHAP authentication failedChapSendChallenge: PPPPKTLEN too small - must be at least %d ChapSendChallenge: unit: %d, Sent id %d.CHAP OKCHAP failureChapSendStatus: PPPPKTLEN too small - must be at least %d ChapSendStatus: Sent code %d, id %d.ChapSendResponse: PPPPKTLEN too small - must be at least %d client state: %s server state: %s challenge xmits: %d challenge replys: %d Chap stats for unit %d, iface %d. epublictrap build failedbuild enterprise failedbuild agent_addr failedheader build failedbuild_var_op failedauth build failedbuild specificType failedbuild timestampfailedbuild trap_type failed%var_system: Unknown magic numbervar_AtEntry: bad magic numbervar_ifAddrEntry: bad magic numbervar_AtEntry: bad magic numberudpEntry: bad magic numbad hdrdataasn build varasn build objbad type&snmp_agt_parse: build opcode failedwrong versionbad communitybad parse of errindexbuild errindex failedincoming pkt too bigbad authenticationbad headerUnsupported message typebad parse of reqidbad parse of errstatsnmp_auth_build failedbuild reqid failedbuild errstat failedinternal error: headerinternal errornot enough space in output packetnot enough space for varlistwrong typesetVariable: INT size not 4 bytesbad headerwrong auth header typebad parse of versionbad parse of communitybuildheaderbuildstringbuildinta!DSNMP ERROR: %s community parsetrap pdu headersys ObjIdtrap typespecific typetimestampvar_op headeragent's IP addresstrap vars headerwrong typevariable~=overflow of messageasn1_parse_int: var too smallnot longbad lengthoverflow of messageI don't support such long stringsasn length too longcan't process ID >= 30we can't support data lengths that longWe don't support indefinite lengthsbuild_lengthoverflow of messageoverflow of messageMalformed NULLasn length too longsuccessfailureparsing GroupName in GroupTableincorrect flags in incoming msgVACM: invalid view typeparsing Name in TargetAddrTableparsing Addr in TargetAddrTableparsing AuthPasswd in UserTableparsing PrivPasswd in UserTableparse:bad flags in incoming pktbuild:bad msgidbuild:bad flagsparse:bad auth boot_cntbuild:bad auth boot_cntparse:bad reqidbuild:bad reqidbuild:bad hderrrcv too-big pktusec:Privacy key